bioLOGIC Data » bioLOGIC CategoryView » bioLOGIC VennView » Experimental Details »
bioLOGIC Category

Results for the Category
negative regulation of transcription, DNA-dependent
(GO:0045892)

RNAi screen result RNAPII IP (MG132) CSB IP CSB IP (MG132) Chrom. Chrom. (MG132) Ubi /Phospo Ubi /Phospho (MG132)
W

Protein Results:

Results for post-translational modifications (below)
Gene name MGoogle Score RNAi high RNAi low RNAPII-IP (MG132) CSB-IP CSB-IP (MG132) Chrom. Chrom. (MG132)
TRIM28 4 -0.250 -0.030 -0.451 -1.012 0.467 -0.209 -0.279
TRIM28 4 -0.250 -0.030
RFC1 3 2.530 -1.230 0.635 1.060 1.028 0.826
UIMC1 3 -1.570 2.710 0.307 -0.624
ATF7IP 3 -1.850 4.120
JUN 3 -0.930 0.930 -0.126
BRCA1 2 0.200 -0.140 0.433 0.018 0.146
BCLAF1 2 -0.180 -0.380
BCLAF1 2 -0.180 -0.380 -0.950 0.737
BCLAF1 2 -0.180 -0.380 0.934 -1.060 0.494 0.092 0.058
RSF1 2 -0.030 -0.300 0.280 -0.177 0.656 0.664 0.625
DDX20 2 -1.700 3.260 -0.911 -0.594 -0.404
DDX20 2 -1.700 3.260 -1.460
SPEN 2 0.970 -0.180 -0.126 -0.082
YBX1 2 -0.180 -0.010 -0.197 -0.190 -1.344 -0.617
GSK3B 2 1.020 -0.870 -1.128 1.091
RCOR1 2 -1.890 3.100 0.185 -0.123 0.523 0.896 0.794
HSPA8 2 -0.640 0.320 0.616 0.207 0.569 0.697 0.187
TIMELESS 2 -0.820 1.340 -0.115 -0.810 1.489 0.880 0.424
TRIM24 2 0.580 -0.300 -1.173 -0.067 -0.484 -0.364
DNMT1 2 0.150 -0.150 0.077 -0.109 -1.422 0.572
DNMT1 2 0.150 -0.150 0.134 -0.347 -0.054
HMGA1 2 -0.300 0.610 -1.084 -0.264
HMGA1 2 -0.300 0.610
POU2F1 2 -0.480 0.830
ZNF148 2 -2.240 3.630 1.104 -0.112 0.692 0.515 0.669
ZNF148 2 -1.020 0.900 1.104 -0.112 0.692 0.515 0.669
NIPBL 2 -0.180 -0.270
NIPBL 2 -0.180 -0.270 1.066 1.181
NIPBL 2 -0.180 -0.270 0.759 0.809 0.590
USP47 2 0.370 -0.540 1.392
USP47 2 0.370 -0.540
ZNF24 2 1.200 -0.960 0.782 0.418 -0.134
STRN3 2 2.050 -0.620 -0.041 0.252 0.509
KDM1A 1 -1.020 1.190 1.814 0.225
KDM1A 1 -1.020 1.190 0.355 0.031 0.593
HDAC9 1 -1.710 3.420
ENO1 1 0.800 -0.580 -0.879 2.255 -2.013 0.739 0.221
KAT6A 1 0.100 -0.500 0.334 0.461
PSMC5 1 0.000 -0.100
PSMC5 1 0.000 -0.100 -0.084 0.014 0.198 -0.612
TFAP4 1 1.270 -0.790
TBL1Y 1 -1.630 3.050 0.090 -3.400 0.909 0.103 0.241
CBY1 1 -1.700 3.270
SNW1 1 -2.350 4.480
SNW1 1 -2.350 4.480 -0.520 -1.264 -0.234 -2.391 -0.788
CHD8 1 -1.310 2.760 -0.896 0.435 0.478 -1.819 -1.191
CHD8 1 -1.310 2.760 -1.168 0.026 0.297
NELFCD 1 2.580 -1.140 -3.196
NKAP 1 1.470 -1.040 -0.400 -0.272 -0.498
CTCF 1 -0.190 0.040 1.656 0.503 0.229 0.942 0.519
CBX1 1 -2.050 3.860 -0.630 0.171 1.328 1.100
MLX 1 2.920 -1.160
PHF12 1 -0.980 1.740
ELF2 1 -0.580 0.480 0.324 0.102
ELF2 1 -0.230 -0.170 0.324 0.102
ELF2 1 -0.580 0.480
ELF2 1 -0.230 -0.170
ELF2 1 -0.580 0.480
ELF2 1 -0.230 -0.170
HDAC1 1 -1.980 4.450
HDAC1 1 -1.980 4.450 -0.122 0.307 0.969 0.094 0.191
CENPF 1 -1.080 2.380 -0.412 -0.373
MSX2 1 -0.260 0.240
KHDRBS1 1 -0.370 -0.090
KHDRBS1 1 -0.370 -0.090 -0.648 -1.258 -0.381 -0.646 -0.079
WWP1 1 -1.400 1.340
WWP1 1 0.850 -1.030
WWP1 1 -1.400 1.340 -0.346 0.023 0.613
WWP1 1 0.850 -1.030 -0.346 0.023 0.613
ILF3 1 -2.400 4.920
ILF3 1 -2.400 4.920 -3.271 -0.998 -0.391 -0.709 -0.019
ILF3 1 -2.400 4.920 -0.465 -5.193 -2.940 -2.419
CHMP1A 1 -2.380 5.780
MYBBP1A 1 -0.860 1.180 0.018 -0.217 -0.365 0.091
YWHAQ 1 -0.260 0.670 0.606 0.369 -0.163 0.594 0.478
MDFIC 1 -0.190 -0.070
MDFIC 1 -0.190 -0.070
NCOA2 1 -0.210 -0.230
PML 1 -0.420 0.350 -0.244 0.322
PEX14 1 -1.140 1.100 -0.395 0.423
PURB 1 -1.320 2.550
HMBOX1 1 0.610 -0.730 4.294
PDCD4 1 -0.500 1.310 0.149
PDCD4 1 -0.500 1.310
TCF7L1 1 -2.040 2.970 -0.741
UBP1 1 2.130 -1.040 0.257 0.528 -0.126
ZHX1 1 -1.880 2.810 -0.193 0.827 -1.444
COPS2 1 -0.730 0.380 0.562 1.638 0.915
RCOR2 1 1.220 -0.890 0.549
RCOR2 1 1.220 -0.890 0.185 -0.123 0.523 0.896 0.794
PA2G4 1 -0.010 0.070
PA2G4 1 -0.010 0.070 1.801 -3.688
PA2G4 1 -0.010 0.070 0.143 0.006 -0.075
SP3 1 2.510 -0.930 -0.403 0.807 0.836
KAT5 1 3.690 -1.200
CTBP2 1 2.270 -1.110
CTBP2 1 2.270 -1.110 1.494 -0.398 0.504 0.897 -0.123
BASP1 1 2.550 -1.210
TAF7 1 0.270 -0.210
SETD8 1 -0.030 0.060
SETD8 1 0.220 0.320
MPHOSPH8 1 0.330 -0.220 0.872 1.388 0.373
NCOR2 1 1.850 -1.050
NCOR2 1 1.850 -1.050 0.037 -1.127
HDAC2 1 -2.390 4.970
HDAC2 1 -2.390 4.970 0.187 -0.007 0.825
TRIM33 1 -1.430 2.720 -0.662 -0.190 0.683 0.034 0.316
GCFC2 0 0.410 -0.260
JARID2 0 -1.180 1.730 -1.360 -1.367
YAF2 0 -0.090 -0.530 -1.631
DEPDC1 0 -0.870 0.970
ARID4A 0 -0.440 1.370 1.114 -1.096 0.597
ZIC2 0 0.440 -0.440
PRDM6 0
SBNO2 0 -0.350 -0.020
TLE2 0 0.520 -0.890 -0.204 -0.609
TLE2 0 0.520 -0.890 0.116
KDM4A 0 1.040 -0.260 -0.576
HDAC4 0 1.730 -0.740
SIRT2 0 0.960 -0.980
SIRT2 0 0.960 -0.980
FBXW11 0 -0.780 0.530 0.532 -1.791 0.313
SMARCE1 0 -0.270 0.280 0.341
SMARCE1 0 -0.270 0.280 0.251 0.796 0.284 0.349
EED 0 -1.210 1.980 0.099 0.896 0.548
TSG101 0 0.060 -0.480
XRCC5 0 1.940 -0.800 0.205 -0.587 0.234 -0.176 0.162
RFX3 0 1.310 -0.470 -1.319 0.299 0.084
RFX3 0 1.310 -0.470
SMARCA2 0 -0.270 0.240 -0.431 -0.133 0.253 0.069 -0.280
REST 0 -0.120 -0.050 -0.002 -1.235 -0.636
MECOM 0 0.130 -0.120 -0.189 0.565 -1.171
MECOM 0 0.740 -0.750 -0.189 0.565 -1.171
DNMT3B 0 0.990 -0.100 0.783 0.015
BIRC5 0 -0.309 -0.536
CBX5 0 0.350 -0.490 0.332 -0.485 0.744 0.961 0.512
BTAF1 0 -1.110 2.110 1.142
HIVEP1 0 0.250 -0.450
SIRT1 0 0.910 -0.910
PATZ1 0 0.540 -0.680 0.512 0.446
BMP7 0
TBL1X 0 -0.240 -0.140 0.090 -3.400 0.909 0.103 0.241
RBBP7 0 -0.080 -0.020 0.602 0.336 0.890 0.363 0.402
RBBP7 0 -0.080 -0.020 0.397 0.000 0.776
RBBP7 0 -0.080 -0.020
ZNF423 0 -0.020 0.030 0.815 0.068
UBE2I 0 -0.320 0.480 -0.694 -0.283 0.274
SALL1 0 -0.080 0.063 0.213 0.247 0.009
KAT8 0 -0.610 0.360
TRPS1 0 -0.640 0.800 -0.396 -0.376 0.670 -0.130 -0.492
AES 0 -0.830 1.120 -1.378
PIAS4 0 -1.510 2.250 -1.454
TGFB1 0 -0.550 1.050
DNAJB6 0 -0.790 1.040
DNAJB6 0 -0.180 -0.540
DNAJB6 0 -0.790 1.040 0.289 0.451
DNAJB6 0 -0.180 -0.540 0.289 0.451
EZH2 0 1.100 -0.960 0.524 0.464 -0.045
GLI3 0 -0.980 1.650
TLE4 0 -0.380 0.600 0.116
TLE4 0 -0.380 0.600
GATA3 0 0.000 -0.660
HDAC5 0 -0.830 1.270
NFKB1 0 0.720 -0.810
SOX6 0 1.430 -0.800
MYF6 0 -0.145 -0.308
CUX2 0 0.330 -0.050
ING4 0 -0.510 0.730
SUDS3 0 -0.520 0.050 0.420 0.543 0.568
SUDS3 0 0.500 -0.230 0.420 0.543 0.568
GMNN 0 0.620 -1.000
DAP 0 0.240 -0.420
WNT5A 0
HES1 0 -0.940 0.860
FOXP1 0 -1.070 2.200
ID2 0 -0.080 -0.630
SUMO1 0 0.450 0.060 -0.088 0.599 0.276 0.608 0.499
KDM5B 0 -0.730 0.300 -3.462 -0.499
PROX1 0 0.800 -0.550
SET 0 -0.480 0.260
SET 0 -0.480 0.260
SET 0 -0.480 0.260 0.464 0.554 0.204 0.186
NR2C1 0 -0.110 0.170
MND1 0 -0.440 1.120
TSHZ3 0 0.170 0.210
ZNF639 0 -0.250 -0.510 -0.298 0.605
TBX22 0 -0.420 0.370
CBX3 0 0.390 0.010 -0.267 -0.513 0.225
PFDN5 0 0.900 -0.490
MXD4 0 1.700 -1.110
RREB1 0 0.330 -0.460 -0.201 -0.613 -0.165
RUNX2 0
LRRFIP1 0 0.280 -0.650
GZF1 0 0.600 -0.700 -1.534
SIN3B 0 0.040 -0.220 0.475 0.416
SMARCA4 0 -0.810 1.520 0.629 -0.158 0.141 0.337 0.333
SNX6 0 0.090 -0.550
RLIM 0 1.810 -0.920 -0.136
INPP5K 0 -0.690 1.160
MEN1 0 1.080 -1.150 0.101 0.684 -0.063
MEN1 0 1.080 -1.150 0.395
MEN1 0 1.080 -1.150
MBD2 0 -1.430 2.250 0.312 1.033
BHLHE40 0 -0.330 0.040
SOX5 0 -0.800 0.810
TBX3 0 -0.160 0.160
AKIRIN2 0 -0.130 0.530
MDM2 0 -0.210 0.080
CREBZF 0 -0.900 1.870
CIR1 0 0.100 -0.530
LEF1 0 -0.710 0.790 -0.741
SMARCC2 0 -0.770 0.630
SMARCC2 0 -0.770 0.630 0.151 0.139 0.622 0.709 0.505
RB1 0 1.180 -1.070 0.429 0.755
RB1 0 1.180 -1.070
BAHD1 0 -0.160 0.160
ZFHX3 0 -0.200 0.390 -0.903 -0.394
NCOR1 0 -0.820 1.130 -0.827 -0.215 0.037
GATA6 0 -0.210 -0.020 -0.027 -0.582 -0.834
TP53 0 -1.070 1.050 -2.808 0.076 -0.094 0.436 0.497
CBX4 0 0.230 0.160 0.798 0.323
MBD1 0 0.490 -0.120 -0.298
SMAD4 0 0.420 -0.390 0.020 0.556 -0.485
NFIC 0 -0.620 0.210
NFIC 0 -0.620 0.210 -0.711 0.025 0.306 1.031
PRDM16 0 -1.320 2.300 -0.189 0.565 -1.171
UBA3 0 0.780 -0.920
LIMD1 0 0.370 -0.740
CDKN2A 0 -0.080 -0.260 -0.556 -1.080 -3.270 -1.110
ZEB1 0 0.640 -0.450
ZEB1 0 0.640 -0.450
TCF7L2 0 -0.550 0.790 -0.741
MTA2 0 -1.360 1.910 0.507 0.478 0.899 0.023 0.072
HMGA2 0 0.340 -0.490
ARID5B 0 0.580 -0.330
DAB2 0 0.510 -0.470
TRIM11 0 -1.020 0.650
PPARGC1B 0 0.740 -0.460
PCGF6 0 0.670 0.070 0.099 -0.103 0.347
MTERF3 0 0.910 -0.750 0.248 0.419
KAT6B 0 0.130 -0.070
DEDD 0 0.120 -0.510
SIM2 0 1.780 -1.300
CTBP1 0 -0.410 0.390
CTBP1 0 -0.410 0.390 -0.293 -0.875 0.361 0.407 -0.049
CTBP1 0 -0.410 0.390 1.494 -0.398 0.504 0.897 -0.123
ARHGAP35 0 1.030 -0.620 -0.833 0.397 0.020
DEDD2 0 0.690 -0.270
NACC1 0 0.300 0.240
GFI1 0 0.150 0.340
ZNF281 0 1.890 -0.960
ZNF281 0 1.890 -0.960 -1.258 0.818 1.187 -0.499
ATF3 0 0.740 -0.540
MSX1 0 0.420 -0.450
PBXIP1 0 0.070 -0.310
IFI16 0 0.400 -0.680 0.620 0.590
YEATS2 0 -0.790 1.760 -1.123 -0.045 -0.324
HMGB2 0 -0.350 0.170 -1.810 0.655 0.285
CDK5 0 -1.100 1.740 -0.236 1.063 0.312
FOXK1 0 -0.290 -0.420
FOXK1 0 -0.290 -0.420 0.639
ZNF219 0 0.770 -0.740
SALL2 0 0.260 -0.270 -0.080 0.063 0.213 0.247 0.009
SALL2 0 0.260 -0.270 -1.479 -1.326 -0.737
BRD7 0 0.610 -0.560 0.433 0.833 0.498
BTRC 0 -0.780 0.690 0.532 -1.791 0.313
NAB2 0 -0.540 0.910
YWHAB 0 0.628 -0.543
YWHAB 0 0.507 0.271 0.503
TSC22D4 0 0.400 -0.490
PHB 0 -1.260 1.640 -0.429 0.649 -1.697
GATAD2A 0 0.970 -0.980 -0.231 0.039 0.770 -0.463 -0.544
CTNNB1 0 0.490 -0.230
CTNNB1 0 0.490 -0.230 -0.415 0.628 0.215
RBPJ 0 1.900 -0.160 -0.367 0.284 0.723 -0.090 0.134
HEXIM2 0 -0.490 1.310
SIN3A 0 -0.610 0.780 0.378 -0.208 0.304 -0.168 0.410
HIC2 0 0.660 -0.600 -0.289 0.965 1.177 0.418 0.340
LIMS1 0 -0.640 0.490 -0.812
LIMS3L 0 -0.812
ZNF282 0 -1.300 1.540 -2.158
PINX1 0 -0.245 0.016
SOX7 0 0.510 -0.520 -0.245 0.016
HDAC3 0 -0.790 1.070
ZNF217 0 1.060 -0.310
ID4 0 0.670 -0.690
CEBPB 0 0.400 -0.930
RELA 0 -1.130 1.600 0.793
ZBTB21 0 -0.780 0.710
ZHX3 0 -0.610 1.630
NR1D2 0 0.660 -0.420
BRMS1 0 -0.780 0.690
SMAD2 0
FOXL1 0 0.560 -0.350 -1.217 -0.424 0.659
EID2 0 -1.000 1.160
TBL1XR1 0 -0.370 0.750 0.090 -3.400 0.909 0.103 0.241
DMAP1 0 0.140 -0.320 -0.406 -0.073 0.671 -0.198 0.239
ZHX2 0 -0.240 0.680 -0.053 0.857
ZBTB7A 0 0.450 -0.890 0.231
PER1 0 1.020 -0.450
CALR 0 -1.300 2.220 0.480 0.054
EHMT1 0 0.540 -0.340 -0.405 0.294 0.151
PLCB1 0 -0.300 -0.220
NKX2-5 0 -0.150 1.230 0.174 0.236
NKX2-5 0 -0.150 1.230 -0.123
GAS6 0 0.020 0.220 -1.517 -0.502
BCOR 0 -0.620 1.340 0.006 -0.709 0.270 -1.186 -0.601
ZNF703 0 0.510 -0.810
PURA 0 -0.470 0.870 0.337 -0.566 0.873
NR2F2 0 -1.120 1.260 -1.119 0.136 0.670
NR2F2 0 -1.120 1.260 0.225 0.992 0.424 0.474
PRAME 0 -0.110 -0.120
NDUFA13 0 1.140 -0.760 -1.093 -0.874 -0.460
YJEFN3 0 -1.093 -0.874 -0.460
NKRF 0 1.390 -0.650 -0.794 -0.472 -0.118 0.250 0.184
NELFB 0 -0.981 -3.214 -1.046 -0.847
ZKSCAN3 0 -0.120 0.260
XRCC6 0 0.960 -0.800
XRCC6 0 0.960 -0.800 -0.089 -0.758 0.145 0.033 0.140
TLE1 0 0.270 0.000 0.116
ARID5A 0 -1.340 2.220
ZGPAT 0 1.020 -1.070 0.249
LDB1 0 0.670 -0.650 -1.168
PRMT6 0 -0.440 0.850
POU3F3 0 -0.340 0.810
MXD3 0 -0.210 -0.290
TWIST2 0 -0.590 0.140

PTM Sites:

Back to Protein Results
Gene name PTM type PTM site UV UV (MG132) Sequence
AES Ubiquitylation K54 0.449 _LASEK(gl)SEMQR_
AES Ubiquitylation K83 0.433 _QAEIVK(gl)R_
AES Ubiquitylation K112 -1.428 -0.846 _AK(gl)QVTAPELNSIIR_
AKIRIN2 Phosphorylation S21 -1.238 -1.325 _RTLDFDPLLSPAS(ph)PK_
ARHGAP35 Phosphorylation S975 -0.388 -0.423 _AGS(ph)PLCNSNLQDSEEDIEPSYSLFR_
ARHGAP35 Phosphorylation S1072 -0.719 _SVS(ph)SSPWLPQDGFDPSDYAEPMDAVVKPR_
ARHGAP35 Phosphorylation S1150 1.218 0.094 _KVS(ph)IVSKPVLYR_
ARHGAP35 Phosphorylation S1179 0.400 0.591 _TSFSVGS(ph)DDELGPIR_
ARID4A Phosphorylation S863 0.509 _ILGQS(ph)SPEKK_
ARID4A Phosphorylation S864 0.184 -0.026 _ILGQSS(ph)PEK_
ARID5A Phosphorylation S300 -0.491 _HGAEPQASPAVHLPESPQS(ph)PK_
ARID5B Phosphorylation S264 0.496 0.623 _RDS(ph)FSGVK_
ATF3 Phosphorylation T162 1.218 _AQNGRT(ph)PEDERNLFIQQIK_
ATF7IP Phosphorylation S121 -0.857 -0.856 _NKQDDDLNCEPLS(ph)PHNITPEPVSK_
ATF7IP Phosphorylation T126 -0.799 _NKQDDDLNCEPLSPHNIT(ph)PEPVSK_
ATF7IP Phosphorylation S453 0.514 0.468 _LAPS(ph)EDELTCFSK_
ATF7IP Phosphorylation S481 -0.400 _M(ox)ES(ph)SFGSPSKQESSESLPK_
ATF7IP Phosphorylation S482 0.543 _MESS(ph)FGSPSKQESSESLPK_
ATF7IP Phosphorylation S485 0.074 0.137 _MESSFGS(ph)PSKQESSESLPK_
ATF7IP Phosphorylation S565 2.282 2.014 _S(ph)KSEDMDNVQSK_
ATF7IP Phosphorylation S567 1.246 _SKS(ph)EDMDNVQSK_
ATF7IP Ubiquitylation K576 -2.103 -0.426 _SKSEDMDNVQSK(gl)R_
ATF7IP Ubiquitylation K596 0.047 0.428 _ITAK(gl)GDINQK_
ATF7IP Ubiquitylation K602 0.100 0.776 _GDINQK(gl)LQK_
ATF7IP Phosphorylation S681 -1.223 _HEHPPNPPVS(ph)PGK_
BAHD1 Phosphorylation S101 -1.220 -2.484 _SADEADELPPDLPKPPS(ph)PAPSSEDPGLAQPR_
BAHD1 Phosphorylation S121 0.411 _LAS(ph)LNAEALNNLLLER_
BAHD1 Phosphorylation S184 -1.095 -0.907 _DLS(ph)PEPAPDEGPR_
BASP1 Ubiquitylation K18 1.496 0.636 _GYNVNDEK(gl)AKEK_
BASP1 Ubiquitylation K20 0.964 0.789 _GYNVNDEKAK(gl)_
BASP1 Ubiquitylation K22 0.978 _GYNVNDEKAKEK(gl)_
BASP1 Phosphorylation T36 -0.229 -0.041 _KAEGAATEEEGT(ph)PKESEPQAAAEPAEAK_
BASP1 Ubiquitylation K52 0.100 -1.026 _ESEPQAAAEPAEAK(gl)EGK_
BASP1 Ubiquitylation K163 -2.086 _KTEAPAAPAAQETK(gl)SDGAPASDSKPGSSEAAPSSK_
BASP1 Phosphorylation S164 -0.762 0.038 _S(ph)DGAPASDSKPGSSEAAPSSK_
BASP1 Ubiquitylation K173 -0.916 -0.418 _SDGAPASDSK(gl)PGSSEAAPSSK_
BASP1 Ubiquitylation K184 -2.030 -2.479 _SDGAPASDSKPGSSEAAPSSK(gl)ETPAATEAPSSTPK_
BASP1 Phosphorylation S194 -0.841 _ETPAATEAPS(ph)STPK_
BASP1 Phosphorylation T196 -0.654 _ETPAATEAPSST(ph)PK_
BASP1 Ubiquitylation K226 -0.819 _AQGPAASAEEPKPVEAPAANSDQTVTVK(gl)E_
BCLAF1 Phosphorylation S177 -0.516 -0.561 _KAEGEPQEES(ph)PLK_
BCLAF1 Phosphorylation S181 -0.748 -0.602 _KAEGEPQEESPLKS(ph)K_
BCLAF1 Phosphorylation S183 2.654 2.903 _S(ph)QEEPKDTFEHDPSESIDEFNK_
BCLAF1 Phosphorylation T190 2.752 _SKSQEEPKDT(ph)FEHDPSESIDEFNK_
BCLAF1 Phosphorylation S196 -0.833 _SQEEPKDTFEHDPS(ph)ESIDEFNK_
BCLAF1 Phosphorylation S198 -1.164 _SQEEPKDTFEHDPSES(ph)IDEFNK_
BCLAF1 Phosphorylation S222 -0.154 -0.066 _SSATSGDIWPGLSAYDNS(ph)PR_
BCLAF1 Phosphorylation S268 -0.125 _NTPSQHSHSIQHS(ph)PER_
BCLAF1 Phosphorylation Y284 1.169 0.845 _Y(ph)SPSQNSPIHHIPSR_
BCLAF1 Phosphorylation S285 0.787 0.744 _Y(ph)S(ph)PSQNSPIHHIPSR_
BCLAF1 Phosphorylation S287 -0.086 0.781 _YS(ph)PS(ph)QNSPIHHIPSR_
BCLAF1 Phosphorylation S290 -0.774 -0.519 _YS(ph)PSQNS(ph)PIHHIPSR_
BCLAF1 Ubiquitylation K332 -0.379 _SSFYPDGGDQETAK(gl)TGK_
BCLAF1 Phosphorylation S337 0.343 _FLKS(ph)PPLHK_
BCLAF1 Phosphorylation T341 4.144 4.415 _RFT(ph)DEESR_
BCLAF1 Phosphorylation Y383 0.945 _AEGEWEDQEALDY(ph)FSDKESGK_
BCLAF1 Phosphorylation S385 0.879 0.910 _GRAEGEWEDQEALDYFS(ph)DKESGK_
BCLAF1 Phosphorylation S397 0.646 0.646 _FNDS(ph)EGDDTEETEDYR_
BCLAF1 Phosphorylation T402 0.754 0.839 _FNDS(ph)EGDDT(ph)EETEDYR_
BCLAF1 Ubiquitylation K437 0.272 _NTEEEGLK(gl)YK_
BCLAF1 Phosphorylation T494 0.602 0.680 _ET(ph)QSPEQVKSEK_
BCLAF1 Phosphorylation S496 0.626 0.617 _KETQS(ph)PEQVK_
BCLAF1 Phosphorylation Y511 0.005 _DLFDY(ph)SPPLHK_
BCLAF1 Phosphorylation S512 0.225 0.163 _LKDLFDYS(ph)PPLHK_
BCLAF1 Phosphorylation S531 0.421 0.441 _STFREES(ph)PLR_
BCLAF1 Phosphorylation T566 -1.236 _MAPVPLDDSNRPASLT(ph)K_
BCLAF1 Ubiquitylation K567 -0.584 _MAPVPLDDSNRPASLTK(gl)DR_
BCLAF1 Ubiquitylation K637 -0.057 _FTSYQK(gl)ATEEHSTR_
BCLAF1 Phosphorylation S648 0.580 0.332 _QKS(ph)PEIHR_
BCLAF1 Phosphorylation S658 0.315 0.496 _IDIS(ph)PSTLRK_
BCLAF1 Phosphorylation S660 0.662 _RIDISPS(ph)TLR_
BCLAF1 Phosphorylation T840 -1.185 -1.707 _EEEWDPEYT(ph)PK_
BCOR Ubiquitylation K40 -0.709 _ILVNDGDASK(gl)AR_
BCOR Phosphorylation S422 -0.216 -0.108 _KDGS(ph)SPPLLEK_
BCOR Phosphorylation S423 -0.363 -0.255 _DGSS(ph)PPLLEK_
BCOR Ubiquitylation K530 1.176 _SMSLKNK(gl)_
BCOR Phosphorylation S1127 -1.150 _QPVSEPPADQVASDMPHS(ph)PTLR_
BCOR Phosphorylation T1129 0.299 _QPVSEPPADQVASDMPHS(ph)PTLR_
BCOR Phosphorylation S1139 -0.208 -0.116 _KVS(ph)GDSSHTETTAEEVPEDPLLK_
BCOR Phosphorylation S1142 0.092 _RKVSGDS(ph)SHTETTAEEVPEDPLLK_
BCOR Phosphorylation T1148 -0.101 0.000 _RKVSGDSSHTETT(ph)AEEVPEDPLLK_
BCOR Phosphorylation S1290 -0.318 _SWSEESLKPSDNEQGLPVFSGS(ph)PPMK_
BCOR Phosphorylation S1410 -0.698 _KRPEPSSDYDLS(ph)PAK_
BCOR Ubiquitylation K1460 0.227 0.495 _RLIVNK(gl)NAGETLLQR_
BHLHE40 Ubiquitylation K159 -0.521 _EVLQYLAK(gl)HENTR_
BHLHE40 Ubiquitylation K262 -1.135 _SEQPCFK(gl)SDHGR_
BHLHE40 Phosphorylation S383 -2.162 _LPS(ph)PLPAHPSVDSSVLLQALKPIPPLNLETKD_
BIRC5 Ubiquitylation K15 -1.446 _(ac)GAPTLPPAWQPFLK(gl)DHR_
BIRC5 Ubiquitylation K113 0.088 -0.061 _HSSGCAFLSVK(gl)K_
BIRC5 Ubiquitylation K114 -0.061 _HSSGCAFLSVK(gl)K_
BMP7 Ubiquitylation K178 -0.107 _IYK(gl)DYIR_
BRCA1 Phosphorylation S123 0.465 0.445 _KENNSPEHLKDEVS(ph)IIQSM(ox)GYR_
BRCA1 Phosphorylation S753 2.662 4.077 _VSNNAEDPKDLMLS(ph)GER_
BRCA1 Phosphorylation S1009 0.733 1.028 _KNLLEENFEEHSM(ox)S(ph)PER_
BRCA1 Phosphorylation S1546 1.821 2.105 _NYPS(ph)QEELIK_
BRCA1 Phosphorylation S1564 3.065 _VVDVEEQQLEES(ph)GPHDLTETSYLPR_
BRCA1 Phosphorylation S1664 1.120 _EKPELTAS(ph)TER_
BRD7 Phosphorylation S279 0.963 0.918 _EREDS(ph)GDAEAHAFK_
BRD7 Phosphorylation S621 -0.540 _AM(ox)GISIPS(ph)PVMENNFVDLTEDTEEPK_
BRMS1 Ubiquitylation K133 0.186 _NK(gl)YECELQGAK_
BTAF1 Ubiquitylation K314 0.577 0.385 _EILK(gl)AHGK_
BTRC Ubiquitylation K466 0.325 _IVSGAYDGKIK(gl)_
CALR Ubiquitylation K48 0.703 _SDFGK(gl)FVLSSGK_
CALR Ubiquitylation K153 -0.924 0.619 _GK(gl)NVLINK_
CALR Ubiquitylation K159 -1.004 0.381 _NVLINK(gl)DIR_
CBX1 Ubiquitylation K35 0.698 _GK(gl)VEYLLK_
CBX1 Phosphorylation S89 0.056 0.422 _ADS(ph)DSEDKGEESKPK_
CBX1 Ubiquitylation K139 -0.287 _WK(gl)NSDEADLVPAK_
CBX1 Ubiquitylation K150 0.289 -0.097 _NSDEADLVPAK(gl)EANVK_
CBX3 Ubiquitylation K5 0.311 0.641 _(ac)ASNK(gl)TTLQK_
CBX3 Ubiquitylation K44 0.789 _VVNGK(gl)VEYFLK_
CBX3 Phosphorylation S93 0.091 0.587 _RKS(ph)LSDSESDDSK_
CBX3 Ubiquitylation K143 0.274 _WK(gl)DSDEADLVLAK_
CBX3 Ubiquitylation K154 0.457 -0.090 _WKDSDEADLVLAK(gl)EANMK_
CBX4 Phosphorylation S291 0.263 0.125 _SGEVAEGEARS(ph)PSHKK_
CBX4 Phosphorylation S293 0.227 _SGEVAEGEARSPS(ph)HKK_
CBX5 Phosphorylation S14 -0.620 0.260 _RTADSSSS(ph)EDEEEYVVEK_
CBX5 Ubiquitylation K32 1.081 _VVK(gl)GQVEYLLK_
CBX5 Ubiquitylation K68 1.329 _NLDCPELISEFMK(gl)K_
CBX5 Ubiquitylation K69 0.893 _NLDCPELISEFMKK(gl)_
CBX5 Ubiquitylation K91 1.360 _K(gl)SNFSNSADDIK_
CBX5 Phosphorylation S92 0.064 -0.325 _RKS(ph)NFSNSADDIK_
CBX5 Ubiquitylation K102 1.233 1.344 _KSNFSNSADDIK(gl)SK_
CBX5 Ubiquitylation K154 0.568 0.740 _WKDTDEADLVLAK(gl)EANVK_
CBY1 Phosphorylation S9 -0.597 -0.810 _PFFGNTFS(ph)PK_
CBY1 Phosphorylation S20 0.383 0.563 _SAS(ph)LSNLHSLDR_
CDK5 Ubiquitylation K56 0.606 0.237 _EICLLK(gl)ELK_
CEBPB Phosphorylation S231 -0.660 _AYLGYQAVPSGSSGSLSTSSSSS(ph)PPGTPSPADAK_
CENPF Ubiquitylation K263 0.419 -0.113 _STLQIGK(gl)R_
CENPF Phosphorylation S276 0.013 _RDANSSFFDNSSS(ph)PHLLDQLK_
CENPF Ubiquitylation K293 -0.460 _NK(gl)INELELR_
CENPF Ubiquitylation K326 -0.856 _FQELQLQLEKAK(gl)_
CENPF Ubiquitylation K513 -1.965 _NIK(gl)QCLNQSQNFAEEMK_
CENPF Ubiquitylation K555 -0.739 -0.237 _INQQENSLTLEK(gl)LK_
CENPF Ubiquitylation K606 0.112 _ALLSALELKK(gl)_
CENPF Ubiquitylation K657 -0.600 0.172 _TQQIK(gl)SHEYNER_
CENPF Ubiquitylation K689 -0.011 _NLHNVLDSK(gl)SVEVETQK_
CENPF Ubiquitylation K770 -1.636 -0.056 _SK(gl)DASLVTNEDHQR_
CENPF Ubiquitylation K823 -1.207 -0.686 _LEADQSPK(gl)NSAILQNR_
CENPF Phosphorylation S834 1.282 _VDS(ph)LEFSLESQK_
CENPF Ubiquitylation K1022 -0.770 _SISELSDQYKQEK(gl)_
CENPF Phosphorylation S1255 2.400 _GDLETSNLQDMQS(ph)QEISGLKDCEIDAEEK_
CENPF Phosphorylation S1747 -0.145 _LQLQGLDLS(ph)SR_
CENPF Phosphorylation S1750 -1.171 -0.117 _S(ph)LLGIDTEDAIQGR_
CENPF Phosphorylation T1825 -0.475 _ITETGAVKPTGECSGEQSPDT(ph)NYEPPGEDK_
CENPF Ubiquitylation K2069 -0.699 _GELDTMSKK(gl)_
CENPF Ubiquitylation K2713 0.058 _MTAK(gl)ETELQR_
CENPF Ubiquitylation K2739 -1.524 _TAELQEELSGEK(gl)NR_
CENPF Phosphorylation S2996 -1.047 -1.005 _GS(ph)PLLGPVVPGPS(ph)PIPSVTEK_
CENPF Phosphorylation S3007 -0.910 -2.059 _GS(ph)PLLGPVVPGPS(ph)PIPSVTEK_
CENPF Phosphorylation S3119 -0.975 -0.328 _LALS(ph)PLSLGK_
CENPF Phosphorylation S3150 1.391 1.078 _VAQRS(ph)PVDSGTILR_
CENPF Phosphorylation S3175 1.052 0.884 _SVPVNNLPERS(ph)PTDSPR_
CHD8 Phosphorylation S557 -0.452 _VPVHQHS(ph)PSEPFLEKPVPDM(ox)TQVSGPNAQLVK_
CHD8 Ubiquitylation K1766 0.498 _EQMK(gl)IEAAER_
CHD8 Phosphorylation S1874 -0.088 -0.155 _TPFKDEIDEFANS(ph)PSEDKEESMEIHATGK_
CHD8 Phosphorylation S1978 0.606 0.061 _M(ox)NYM(ox)QNHQAGAPAPSLS(ph)R_
CHD8 Phosphorylation T1993 -1.383 -1.407 _T(ph)ASPLPLRPDAPVEKS(ph)PEETATQVPSLESLTLK_
CHD8 Phosphorylation S1995 -0.690 -1.351 _TAS(ph)PLPLRPDAPVEK_
CHD8 Phosphorylation S2008 -1.339 -1.407 _T(ph)ASPLPLRPDAPVEKS(ph)PEETATQVPSLESLTLK_
CHD8 Phosphorylation S2046 0.427 0.449 _VS(ph)PSDTTPLVSR_
CHD8 Phosphorylation S2519 -0.083 -0.552 _APGYPSS(ph)PVTTASGTTLR_
CHD8 Phosphorylation S2533 -0.792 _RTS(ph)LSAEDAEVTK_
CHD8 Phosphorylation S2559 -0.345 -0.513 _NIPS(ph)PGQLDPDTR_
CHD8 Phosphorylation S2956 0.383 -0.248 _DGETLEGS(ph)DAEESLDK_
CHMP1A Ubiquitylation K40 1.065 0.286 _ALLQK(gl)NVECAR_
CHMP1A Ubiquitylation K55 0.592 _K(gl)KNEGVNWLR_
CHMP1A Ubiquitylation K56 0.592 _K(gl)KNEGVNWLR_
CHMP1A Ubiquitylation K87 1.017 0.050 _VQTAVTMKGVTK(gl)_
CHMP1A Ubiquitylation K94 0.333 _NMAQVTK(gl)ALDK_
CIR1 Phosphorylation S202 -0.296 -0.615 _NLTANDPSQEYVAS(ph)EGEEDPEVEFLK_
COPS2 Ubiquitylation K423 0.078 1.264 _IDQVNQLLELDHQK(gl)R_
COPS2 Ubiquitylation K434 0.640 0.787 _YTALDK(gl)WTNQLNSLNQAVVSK_
CREBZF Phosphorylation S50 0.698 0.641 _AAAGEEETAAAGS(ph)PGRK_
CTBP1 Ubiquitylation K279 0.443 _GGLVDEK(gl)ALAQALK_
CTBP1 Ubiquitylation K286 0.130 0.008 _ALAQALK(gl)EGR_
CTBP1 Phosphorylation S492 -1.548 _YPPGIVGVAPGGLPAAM(ox)EGIIPGGIPVTHNLPTVAHPS(ph)QAPSPNQPTK_
CTBP2 Ubiquitylation K6 0.873 0.855 _(ac)ALVDK(gl)HK_
CTBP2 Ubiquitylation K279 0.443 _GGLVDEK(gl)ALAQALK_
CTBP2 Ubiquitylation K286 0.130 0.008 _ALAQALK(gl)EGR_
CTBP2 Phosphorylation S492 -1.548 _YPPGIVGVAPGGLPAAM(ox)EGIIPGGIPVTHNLPTVAHPS(ph)QAPSPNQPTK_
CTNNB1 Ubiquitylation K158 -1.265 _AIPELTK(gl)LLNDEDQVVVNK_
CTNNB1 Ubiquitylation K180 -0.546 -0.636 _AAVM(ox)VHQLSK(gl)K_
CTNNB1 Ubiquitylation K181 -0.717 -0.729 _AAVMVHQLSKK(gl)_
CTNNB1 Phosphorylation S191 -0.024 0.129 _S(ph)PQMVSAIVR_
CTNNB1 Ubiquitylation K435 -0.350 _NK(gl)MM(ox)VCQVGGIEALVR_
CTNNB1 Ubiquitylation K496 -1.262 _LHYGLPVVVK(gl)_
CTNNB1 Phosphorylation S552 1.233 1.224 _RTS(ph)MGGTQQQFVEGVR_
CTNNB1 Phosphorylation T556 1.275 0.995 _RTSM(ox)GGT(ph)QQQFVEGVR_
CTNNB1 Ubiquitylation K671 -0.941 -0.934 _MSEDKPQDYK(gl)K_
CUX2 Ubiquitylation K568 -0.653 _EQLLK(gl)HNIGQR_
DAB2 Phosphorylation S401 -0.704 -0.722 _SSPNPFVGS(ph)PPK_
DAP Phosphorylation S2 -0.404 1.136 _(ac)S(ph)SPPEGKLETK_
DAP Phosphorylation S3 -0.404 1.254 _(ac)SS(ph)PPEGKLETK_
DAP Phosphorylation S51 -0.968 0.151 _DKDDQEWESPS(ph)PPKPTVFISGVIAR_
DDX20 Phosphorylation S268 1.509 _LNS(ph)SDPSLIGLK_
DDX20 Ubiquitylation K356 0.817 -0.217 _LDAMAKLK(gl)_
DDX20 Phosphorylation T531 0.063 0.240 _AT(ph)SPKELGCDR_
DDX20 Phosphorylation S532 -1.143 -0.447 _ATS(ph)PKELGCDR_
DDX20 Phosphorylation S714 -0.225 0.002 _YQES(ph)PGIQM(ox)K_
DDX20 Ubiquitylation K720 -1.179 _YQESPGIQMK(gl)TR_
DEDD Ubiquitylation K237 0.372 _FNQANTILK(gl)SR_
DEDD2 Ubiquitylation K193 -2.121 _GAPAAPQQQSEPARPSSEGK(gl)VTCDIR_
DEPDC1 Ubiquitylation K113 -3.374 _FPATSPLK(gl)TLPR_
DEPDC1 Ubiquitylation K777 -0.155 _EYPLIYQK(gl)R_
DMAP1 Ubiquitylation K192 -0.293 _SVEDLK(gl)ER_
DMAP1 Phosphorylation T445 -0.299 -0.664 _DTIIDVVGAPLT(ph)PNSR_
DNAJB6 Ubiquitylation K20 -0.317 _HASPEDIK(gl)K_
DNAJB6 Ubiquitylation K21 -0.099 -0.377 _HASPEDIKK(gl)AYR_
DNAJB6 Ubiquitylation K60 -0.122 _QVAEAYEVLSDAK(gl)KR_
DNAJB6 Ubiquitylation K61 -0.105 -0.122 _QVAEAYEVLSDAKK(gl)R_
DNAJB6 Ubiquitylation K67 0.497 0.717 _DIYDK(gl)YGK_
DNAJB6 Ubiquitylation K196 -0.221 _SISTSTK(gl)MVNGR_
DNAJB6 Phosphorylation S277 0.267 _HAPHCLS(ph)EEEGEQDRPR_
DNMT1 Phosphorylation S127 -0.755 -0.836 _VGM(ox)ADANS(ph)PPKPLSKPR_
DNMT1 Phosphorylation S143 0.877 0.220 _SKS(ph)DGEAKPEPSPSPR_
DNMT1 Phosphorylation S152 -0.685 -1.347 _SDGEAKPEPS(ph)PSPR_
DNMT1 Phosphorylation S154 -1.926 -0.876 _SDGEAKPEPSPS(ph)PR_
DNMT1 Ubiquitylation K586 1.686 3.368 _DLIK(gl)LAGVTLGQR_
DNMT1 Ubiquitylation K675 1.267 0.915 _DMVK(gl)FGGSGR_
DNMT1 Phosphorylation S714 -0.773 -0.554 _EADDDEEVDDNIPEMPS(ph)PKK_
DNMT1 Phosphorylation S954 -0.318 0.057 _LSS(ph)PVKRPR_
DNMT1 Ubiquitylation K961 -3.166 _K(gl)EPVDEDLYPEHYR_
DNMT1 Ubiquitylation K981 -0.298 -1.482 _YSDYIK(gl)GSNLDAPEPYR_
DNMT1 Ubiquitylation K997 0.042 0.154 _IK(gl)EIFCPK_
DNMT1 Ubiquitylation K1483 1.983 -0.103 _GVCSCVEAGK(gl)ACDPAAR_
DNMT3B Ubiquitylation K597 0.236 _ELGIK(gl)VGK_
DNMT3B Ubiquitylation K623 0.433 _HEGNIK(gl)YVNDVR_
EHMT1 Ubiquitylation K827 -0.048 0.076 _YLIK(gl)AGALVDPK_
EHMT1 Ubiquitylation K970 0.967 0.775 _DSDVTLKNK(gl)_
EID2 Phosphorylation S94 -0.850 _AAAAGRES(ph)PAAAAAR_
ELF2 Ubiquitylation K245 -1.504 _LVDSK(gl)AVSK_
ELF2 Ubiquitylation K280 -0.045 _GILAK(gl)VEGQR_
ELF2 Phosphorylation S424 1.797 0.535 _ISTVAVQSVNAGAPLITSTS(ph)PTTATSPK_
ENO1 Ubiquitylation K5 0.389 0.802 _(ac)SILK(gl)IHAR_
ENO1 Ubiquitylation K60 0.769 1.153 _YMGK(gl)GVSK_
ENO1 Ubiquitylation K64 0.708 0.799 _GVSK(gl)AVEHINK_
ENO1 Ubiquitylation K71 0.221 0.294 _AVEHINK(gl)TIAPALVSK_
ENO1 Ubiquitylation K80 0.008 _TIAPALVSK(gl)K_
ENO1 Ubiquitylation K81 0.220 0.476 _K(gl)LNVTEQEKIDK_
ENO1 Ubiquitylation K89 1.139 _KLNVTEQEK(gl)IDK_
ENO1 Ubiquitylation K126 -0.530 0.435 _AGAVEK(gl)GVPLYR_
ENO1 Ubiquitylation K193 1.145 _IGAEVYHNLK(gl)NVIK_
ENO1 Ubiquitylation K197 1.066 1.367 _IGAEVYHNLKNVIK(gl)_
ENO1 Ubiquitylation K199 0.592 0.434 _NVIKEK(gl)YGK_
ENO1 Ubiquitylation K202 -0.137 0.899 _YGK(gl)DATNVGDEGGFAPNILENK_
ENO1 Ubiquitylation K233 0.597 _TAIGK(gl)AGYTDK_
ENO1 Ubiquitylation K256 -0.004 -0.216 _SGK(gl)YDLDFKSPDDPSR_
ENO1 Ubiquitylation K262 -1.294 -0.324 _SGKYDLDFK(gl)SPDDPSR_
ENO1 Phosphorylation S272 0.075 0.358 _YIS(ph)PDQLADLYK_
ENO1 Ubiquitylation K326 -0.383 _FTASAGIQVVGDDLTVTNPK(gl)R_
ENO1 Ubiquitylation K330 1.093 _RIAK(gl)AVNEK_
ENO1 Ubiquitylation K335 0.564 0.437 _AVNEK(gl)SCNCLLLK_
ENO1 Ubiquitylation K406 0.892 0.279 _LAK(gl)YNQLLR_
ENO1 Phosphorylation S419 0.673 0.511 _IEEELGS(ph)KAK_
ENO1 Ubiquitylation K420 0.442 0.409 _IEEELGSK(gl)AK_
ENO1 Ubiquitylation K422 0.439 _IEEELGSKAK(gl)_
ENO1 Ubiquitylation K434 -0.324 _NFRNPLAK(gl)_
EZH2 Ubiquitylation K61 0.548 _TEILNQEWK(gl)QR_
EZH2 Phosphorylation S363 0.010 -0.733 _GRLPNNSS(ph)RPSTPTINVLESK_
EZH2 Phosphorylation S366 -0.266 -0.699 _GRLPNNSSRPS(ph)TPTINVLESK_
EZH2 Phosphorylation T367 0.320 -0.372 _LPNNSSRPST(ph)PTINVLESK_
EZH2 Phosphorylation T369 -0.911 _GRLPNNSSRPSTPT(ph)INVLESK_
EZH2 Phosphorylation T487 -0.501 -0.532 _VKESSIIAPAPAEDVDT(ph)PPR_
EZH2 Ubiquitylation K569 -0.974 _AQCNTK(gl)QCPCYLAVR_
EZH2 Ubiquitylation K713 -0.461 _IGIFAK(gl)R_
EZH2 Ubiquitylation K735 0.038 _YSQADALK(gl)YVGIER_
FBXW11 Ubiquitylation K466 0.325 _IVSGAYDGKIK(gl)_
FOXK1 Phosphorylation S213 -0.810 -0.624 _IQFTSLYHKEEAPAS(ph)PLRPLYPQIS(ph)PLK_
FOXK1 Phosphorylation S223 -1.752 -1.220 _IQFTSLYHKEEAPAS(ph)PLRPLYPQIS(ph)PLK_
FOXK1 Phosphorylation S239 -0.701 _SM(ox)VS(ph)PVPSPTGTISVPNSCPAS(ph)PR_
FOXK1 Phosphorylation S243 -1.155 -0.657 _SM(ox)VSPVPS(ph)PTGTISVPNSCPAS(ph)PR_
FOXK1 Phosphorylation S257 -0.928 -0.657 _SM(ox)VSPVPS(ph)PTGTISVPNSCPAS(ph)PR_
FOXK1 Ubiquitylation K353 0.010 -1.365 _SQEEPGK(gl)GSFWR_
FOXK1 Phosphorylation S416 0.350 -0.992 _S(ph)APAS(ph)PTHPGLMSPR_
FOXK1 Phosphorylation S420 -0.935 -0.842 _SAPAS(ph)PTHPGLMSPR_
FOXK1 Phosphorylation S428 0.360 _SAPAS(ph)PTHPGLMS(ph)PR_
FOXK1 Phosphorylation T436 0.628 0.334 _SGGLQT(ph)PECLS(ph)R_
FOXK1 Phosphorylation S441 -0.200 -0.052 _SGGLQT(ph)PECLS(ph)R_
FOXK1 Phosphorylation S445 -0.629 -0.621 _EGS(ph)PIPHDPEFGSK_
FOXL1 Phosphorylation S6 0.325 0.055 _YS(ph)VSSPNSLGVVPYLGGEQSYYR_
FOXL1 Phosphorylation S235 -1.239 _TENGTCPS(ph)PPQPLS(ph)PAAALGSGSAAAVPK_
FOXL1 Phosphorylation S241 -1.239 _TENGTCPS(ph)PPQPLS(ph)PAAALGSGSAAAVPK_
FOXL1 Phosphorylation S259 -0.376 -0.198 _IES(ph)PDSSSSSLSSGSSPPGSLPSAR_
FOXL1 Phosphorylation S320 0.313 0.178 _GS(ph)PQSAAAELSSGLLASAAASSR_
FOXL1 Phosphorylation S323 0.347 _GSPQS(ph)AAAELSSGLLASAAASSR_
FOXL1 Ubiquitylation K554 -0.030 0.013 _TSGAFVYDCSK(gl)F_
FOXP1 Phosphorylation S442 1.013 0.678 _RYS(ph)DKYNVPISSADIAQNQEFYK_
GATA3 Phosphorylation S162 -1.195 -0.563 _DVS(ph)PDPSLSTPGSAGSAR_
GATAD2A Phosphorylation T68 -0.595 _GLLASDLNTDGDM(ox)RVT(ph)PEPGAGPTQGLLR_
GATAD2A Phosphorylation S119 -0.992 -0.978 _RPPS(ph)PDVIVLSDNEQPSSPR_
GATAD2A Phosphorylation S132 -0.919 _RPPS(ph)PDVIVLSDNEQPS(ph)SPR_
GATAD2A Phosphorylation S133 -0.992 _RPPS(ph)PDVIVLSDNEQPSS(ph)PR_
GATAD2A Phosphorylation T194 -0.162 0.323 _EAT(ph)AQKPTGSVGSTVTTPPPLVR_
GATAD2A Phosphorylation T208 0.247 _EATAQKPTGSVGSTVTT(ph)PPPLVR_
GATAD2A Phosphorylation S359 -1.184 -0.716 _GTTATSAQANSTPTSVASVVTSAES(ph)PASR_
GCFC2 Phosphorylation S180 -0.852 -0.536 _RESEDDPES(ph)EPDDHEK_
GFI1 Phosphorylation S68 0.285 0.145 _DRLS(ph)PESQLTEAPDR_
GLI3 Phosphorylation S664 -0.582 -0.252 _S(ph)PGRPTQGALGEQQDLSNTTSK_
GMNN Ubiquitylation K50 -0.622 -0.151 _ENELSAGLSK(gl)R_
GMNN Phosphorylation S63 0.028 -0.793 _NDHLTSTTS(ph)SPGVIVPESSENK_
GSK3B Phosphorylation S9 -0.483 0.010 _TTS(ph)FAESCKPVQQPSAFGSMK_
GSK3B Ubiquitylation K85 -0.204 _LCDSGELVAIK(gl)K_
GSK3B Ubiquitylation K86 -0.204 _LCDSGELVAIK(gl)K_
GSK3B Phosphorylation S215 0.296 0.477 _GEPNVS(ph)YICSR_
GSK3B Phosphorylation Y216 0.356 0.376 _GEPNVSY(ph)ICSR_
GSK3B Phosphorylation T390 2.800 2.527 _IQAAAST(ph)PTNATAASDANTGDR_
GZF1 Phosphorylation S613 -0.102 _SFLVIVDGS(ph)PK_
HDAC1 Ubiquitylation K50 0.036 _K(gl)MEIYRPHK_
HDAC1 Ubiquitylation K66 -0.593 _ANAEEMTK(gl)YHSDDYIK_
HDAC1 Ubiquitylation K74 0.620 -1.473 _YHSDDYIK(gl)FLR_
HDAC1 Ubiquitylation K89 0.749 -0.241 _SIRPDNMSEYSK(gl)QMQR_
HDAC1 Phosphorylation S393 -1.133 -1.144 _M(ox)LPHAPGVQM(ox)QAIPEDAIPEES(ph)GDEDEDDPDKR_
HDAC1 Phosphorylation S409 1.326 1.144 _ISICS(ph)SDKR_
HDAC1 Phosphorylation S410 1.326 1.144 _ISICS(ph)SDKR_
HDAC1 Ubiquitylation K412 0.642 -0.744 _ISICSSDK(gl)R_
HDAC2 Ubiquitylation K50 0.036 _K(gl)MEIYRPHK_
HDAC2 Ubiquitylation K67 -0.467 _ATAEEMTK(gl)YHSDEYIK_
HDAC2 Ubiquitylation K89 0.749 -0.241 _SIRPDNMSEYSK(gl)QMQR_
HDAC2 Ubiquitylation K284 0.749 _GHAK(gl)CVEVVK_
HDAC2 Phosphorylation S394 -0.865 -0.997 _M(ox)LPHAPGVQM(ox)QAIPEDAVHEDS(ph)GDEDGEDPDKR_
HDAC2 Phosphorylation S422 0.482 0.781 _IACDEEFS(ph)DSEDEGEGGR_
HDAC3 Phosphorylation S424 -0.354 _GPEENYSRPEAPNEFYDGDHDNDKES(ph)DVEI_
HDAC4 Phosphorylation S265 -0.390 _RS(ph)SPLLR_
HDAC4 Phosphorylation S266 -0.821 -0.598 _RSS(ph)PLLR_
HDAC4 Phosphorylation S632 -1.146 -0.837 _AQS(ph)SPASATFPVSVQEPPTKPR_
HDAC5 Phosphorylation S265 -0.390 _RS(ph)SPLLR_
HDAC5 Phosphorylation S266 -0.821 -0.598 _RSS(ph)PLLR_
HDAC9 Phosphorylation S265 -0.390 _RS(ph)SPLLR_
HDAC9 Phosphorylation S266 -0.821 -0.598 _RSS(ph)PLLR_
HES1 Ubiquitylation K66 0.212 _TLILDALK(gl)K_
HES1 Ubiquitylation K67 0.212 _TLILDALK(gl)K_
HES1 Ubiquitylation K109 -0.891 _AQMTAALSTDPSVLGK(gl)YR_
HEXIM2 Phosphorylation S14 0.794 _(ac)MMATPNQTACNAES(ph)PVALEEAK_
HEXIM2 Phosphorylation S76 0.437 -0.036 _TQS(ph)PGGCSAEAVLAR_
HIC2 Phosphorylation S348 0.387 -0.385 _KEPVAGS(ph)PFER_
HIVEP1 Phosphorylation S536 -0.085 _SSFTPS(ph)SPENVIGDFLLQDR_
HIVEP1 Phosphorylation S537 -0.271 _SSFTPSS(ph)PENVIGDFLLQDR_
HIVEP1 Ubiquitylation K661 -0.483 -1.267 _QQATDYSQEQQGK(gl)LLSPR_
HIVEP1 Phosphorylation S698 -0.377 -0.112 _RLPS(ph)TEQDSGR_
HIVEP1 Phosphorylation S1180 0.116 0.892 _VIGIS(ph)QEESHPSR_
HIVEP1 Phosphorylation S1735 0.650 _ISVGRLS(ph)PQQESSASSK_
HIVEP1 Phosphorylation S2682 0.637 _AHSEVFTKPSGQQTLS(ph)PDR_
HMBOX1 Phosphorylation S171 1.047 1.106 _RDSS(ph)VIKEEIK_
HMGA1 Phosphorylation S2 -0.266 1.155 _(ac)S(ph)ESSSKS(ph)SQPLASK_
HMGA1 Phosphorylation S4 0.519 _(ac)SES(ph)SSKS(ph)SQPLASK_
HMGA1 Phosphorylation S5 0.398 0.365 _(ac)SESS(ph)SKSSQPLASK_
HMGA1 Phosphorylation S6 0.475 0.368 _(ac)SESSS(ph)KSSQPLASK_
HMGA1 Ubiquitylation K7 0.088 0.752 _(ac)SESSSK(gl)SSQPLASK_
HMGA1 Phosphorylation S8 2.198 2.240 _(ac)SESSSKS(ph)SQPLASK_
HMGA1 Phosphorylation S9 1.976 2.155 _(ac)SESSSKSS(ph)QPLASK_
HMGA1 Ubiquitylation K15 0.114 -0.136 _SSQPLASK(gl)QEKDGTEK_
HMGA1 Ubiquitylation K18 0.073 -0.136 _SSQPLASKQEK(gl)_
HMGA1 Phosphorylation S36 -1.043 -0.690 _KQPPVS(ph)PGTALVGSQK_
HMGA1 Phosphorylation S44 -0.035 0.111 _KQPPVSPGTALVGS(ph)QKEPSEVPTPK_
HMGA1 Ubiquitylation K46 -1.742 _KQPPVSPGTALVGSQK(gl)EPSEVPTPK_
HMGA1 Phosphorylation S49 -2.923 0.166 _KQPPVSPGTALVGSQKEPS(ph)EVPTPK_
HMGA1 Phosphorylation T53 -2.612 -2.477 _KQPPVSPGTALVGSQKEPSEVPT(ph)PK_
HMGA1 Phosphorylation S102 -0.522 -0.117 _KLEKEEEEGISQES(ph)SEEEQ_
HMGA1 Phosphorylation S103 0.370 _EEEEGISQESS(ph)EEEQ_
HMGA2 Phosphorylation S44 -0.564 -0.762 _KQQQEPTGEPS(ph)PK_
HMGA2 Phosphorylation S105 -0.055 -0.046 _KPAQEETEETSSQES(ph)AEED_
HMGB2 Ubiquitylation K114 0.323 _IK(gl)SEHPGLSIGDTAK_
HMGB2 Ubiquitylation K128 0.363 _K(gl)LGEMWSEQSAK_
HMGB2 Ubiquitylation K147 0.205 -0.408 _DKQPYEQK(gl)AAK_
HMGB2 Ubiquitylation K150 -0.251 _DKQPYEQKAAK(gl)_
HSPA8 Ubiquitylation K3 -0.324 _(ac)SK(gl)GPAVGIDLGTTYSCVGVFQHGK_
HSPA8 Ubiquitylation K56 -0.260 1.224 _LIGDAAK(gl)NQVAMNPTNTVFDAK(gl)R_
HSPA8 Ubiquitylation K71 0.041 1.713 _NQVAM(ox)NPTNTVFDAK(gl)R_
HSPA8 Ubiquitylation K108 0.301 0.877 _VQVEYK(gl)GETK_
HSPA8 Ubiquitylation K126 -0.071 0.472 _SFYPEEVSSMVLTK(gl)MK_
HSPA8 Ubiquitylation K128 1.160 0.420 _MK(gl)EIAEAYLGK_
HSPA8 Ubiquitylation K159 0.192 2.025 _QATK(gl)DAGTIAGLNVLR_
HSPA8 Ubiquitylation K187 0.744 _IINEPTAAAIAYGLDK(gl)K_
HSPA8 Ubiquitylation K188 -0.076 0.744 _IINEPTAAAIAYGLDKK(gl)_
HSPA8 Ubiquitylation K319 0.026 -0.313 _GTLDPVEK(gl)ALR_
HSPA8 Ubiquitylation K325 0.501 -0.341 _ALRDAK(gl)LDK_
HSPA8 Ubiquitylation K328 -0.057 0.670 _LDK(gl)SQIHDIVLVGGSTR_
HSPA8 Ubiquitylation K348 0.390 3.929 _IQK(gl)LLQDFFNGK_
HSPA8 Ubiquitylation K357 0.339 _LLQDFFNGK(gl)ELNK_
HSPA8 Ubiquitylation K451 0.095 0.846 _AMTK(gl)DNNLLGK_
HSPA8 Ubiquitylation K497 0.354 0.667 _STGK(gl)ENKITITNDK_
HSPA8 Ubiquitylation K500 0.066 1.038 _ENK(gl)ITITNDK_
HSPA8 Ubiquitylation K507 -0.228 -0.104 _ITITNDK(gl)GR_
HSPA8 Ubiquitylation K512 0.321 0.692 _LSK(gl)EDIER_
HSPA8 Ubiquitylation K524 0.032 -0.180 _M(ox)VQEAEK(gl)YKAEDEKQR_
HSPA8 Ubiquitylation K526 4.133 0.230 _MVQEAEKYK(gl)AEDEK_
HSPA8 Ubiquitylation K531 1.093 _MVQEAEK(gl)YKAEDEK(gl)QR_
HSPA8 Ubiquitylation K539 -0.121 0.409 _VSSK(gl)NSLESYAFNMK_
HSPA8 Ubiquitylation K557 -0.270 _ATVEDEK(gl)LQGK_
HSPA8 Ubiquitylation K597 0.282 _NQTAEKEEFEHQQK(gl)ELEK_
HSPA8 Ubiquitylation K601 0.005 0.196 _ELEK(gl)VCNPIITK_
ID2 Phosphorylation S14 -0.139 _NS(ph)LSDHSLGISR_
ID4 Phosphorylation S5 -0.437 -0.234 _AVS(ph)PVRPSGR_
ILF3 Phosphorylation S62 -0.267 -0.683 _GSSEQAES(ph)DNMDVPPEDDSK_
ILF3 Ubiquitylation K100 0.868 0.952 _VGLVAK(gl)GLLLK_
ILF3 Ubiquitylation K119 0.194 _EK(gl)PTTALLDK_
ILF3 Ubiquitylation K202 0.668 0.564 _QK(gl)CLAALASLR_
ILF3 Phosphorylation S382 0.107 0.115 _RPM(ox)EEDGEEKS(ph)PSK_
ILF3 Phosphorylation S384 0.054 _RPM(ox)EEDGEEKS(ph)PSK_
ILF3 Ubiquitylation K454 1.019 _TAK(gl)LHVAVK_
ILF3 Phosphorylation S482 -1.214 -1.233 _GEDS(ph)AEETEAKPAVVAPAPVVEAVSTPSAAFPSDATAENVK_
ILF3 Phosphorylation S482 -1.655 -1.471 _GEDS(ph)AEETEAKPAVVAPAPVVEAVSTPSAAFPSDATAEQGPILTK_
ILF3 Phosphorylation T486 -1.747 -6.485 _DSSKGEDSAEET(ph)EAKPAVVAPAPVVEAVSTPSAAFPSDATAENVK_
ILF3 Phosphorylation T486 -1.655 -1.310 _GEDS(ph)AEETEAKPAVVAPAPVVEAVSTPSAAFPSDATAEQGPILTK_
ILF3 Phosphorylation T592 -0.375 -0.375 _LFPDT(ph)PLALDANK_
ILF3 Ubiquitylation K604 -0.285 _LFPDTPLALDANK(gl)K_
ILF3 Ubiquitylation K605 -0.285 _LFPDTPLALDANK(gl)K_
ILF3 Phosphorylation S812 0.288 0.380 _FNYSGS(ph)GGR_
ING4 Ubiquitylation K114 0.730 _FEADLKEK(gl)_
INPP5K Ubiquitylation K248 -0.741 0.167 _LLFPPTYK(gl)FDR_
JARID2 Phosphorylation S455 -0.219 -0.009 _LEEAHQAEKPQS(ph)PPK_
JUN Phosphorylation S58 -0.167 -1.247 _AKNS(ph)DLLTSPDVGLLK_
JUN Phosphorylation T62 2.545 1.674 _NSDLLT(ph)SPDVGLLK_
JUN Phosphorylation S63 2.030 1.458 _NSDLLTS(ph)PDVGLLK_
JUN Ubiquitylation K70 9.213 _NSDLLTSPDVGLLK(gl)_
JUN Phosphorylation S73 1.499 0.845 _LAS(ph)PELER_
JUN Phosphorylation S243 -0.642 -1.399 _LQALKEEPQTVPEMPGETPPLS(ph)PIDMESQER_
JUN Ubiquitylation K309 1.034 0.155 _EQVAQLK(gl)QK_
KAT5 Ubiquitylation K230 -0.079 _MK(gl)NIECIELGR_
KAT5 Ubiquitylation K274 -0.149 _SLK(gl)CLQR_
KAT6A Phosphorylation S473 2.569 _LFGS(ph)QEIMTEK_
KAT6A Phosphorylation S1001 -0.884 -0.411 _SSS(ph)PPILTKPTLK_
KAT6A Phosphorylation S1089 0.499 0.643 _RLS(ph)SQDVLR_
KAT6A Phosphorylation S1090 0.740 1.024 _RLSS(ph)QDVLR_
KAT6A Phosphorylation S1113 -0.700 _SKDEEEDEES(ph)DDADDTPILKPVSLLR_
KAT6B Phosphorylation S1048 0.487 _YLHS(ph)PESRPVTGER_
KAT8 Phosphorylation S37 -2.803 _(ac)AAQGAAAAVAAGTSGVAGEGEPGPGENAAAEGTAPS(ph)PGRVS(ph)PPTPAR_
KAT8 Phosphorylation S42 -2.803 _(ac)AAQGAAAAVAAGTSGVAGEGEPGPGENAAAEGTAPS(ph)PGRVS(ph)PPTPAR_
KDM1A Phosphorylation S69 -2.048 -2.645 _KEPPRAS(ph)PPGGLAEPPGSAGPQAGPTVVPGSATPMETGIAETPEGR_
KDM1A Phosphorylation T88 -1.832 _KEPPRASPPGGLAEPPGSAGPQAGPT(ph)VVPGSATPM(ox)ETGIAETPEGR_
KDM1A Phosphorylation S126 0.780 0.501 _EMDES(ph)LANLSEDEYYS(ph)EEER_
KDM1A Phosphorylation S131 0.204 0.473 _EM(ox)DESLANLS(ph)EDEYYS(ph)EEER_
KDM1A Phosphorylation S137 0.122 0.511 _EM(ox)DESLANLS(ph)EDEYYS(ph)EEER_
KDM1A Phosphorylation S166 -2.328 -2.624 _KLPPPPPQAPPEEENES(ph)EPEEPSGVEGAAFQSR_
KDM1A Ubiquitylation K296 -0.820 _IKPLPTK(gl)K_
KDM1A Ubiquitylation K297 -0.820 _IKPLPTK(gl)K_
KDM1A Ubiquitylation K507 -1.073 _DITAEFLVKSK(gl)_
KDM4A Ubiquitylation K105 -1.070 _IANSDK(gl)YCTPR_
KDM4A Ubiquitylation K251 -0.699 _MTLISPLMLK(gl)K_
KDM4A Ubiquitylation K252 -0.699 _MTLISPLMLK(gl)K_
KDM4A Ubiquitylation K820 -1.283 _SPVDVSK(gl)IPLPR_
KDM4A Ubiquitylation K893 -0.347 _AK(gl)GALQSITAGQK_
KDM5B Ubiquitylation K158 0.884 _IATK(gl)MGFAPGK_
KDM5B Ubiquitylation K242 -1.046 -0.314 _AEAMNIK(gl)IEPEETTEAR_
KDM5B Ubiquitylation K639 -0.221 _MASK(gl)ADVLDVVVASTVQK_
KDM5B Ubiquitylation K832 -0.689 _SGGGK(gl)SQNQLTVNELR_
KDM5B Ubiquitylation K1102 -0.038 _CDIGLLGLK(gl)R_
KDM5B Ubiquitylation K1136 -0.421 _ALTESK(gl)ETASAMATLGEAR_
KDM5B Ubiquitylation K1276 -0.023 _AQQLLSSGNLK(gl)FVQDR_
KHDRBS1 Phosphorylation S18 0.745 -0.921 _S(ph)GSM(ox)DPSGAHPSVR_
KHDRBS1 Phosphorylation S20 0.944 -0.215 _SGS(ph)M(ox)DPSGAHPSVR_
KHDRBS1 Phosphorylation S58 9.021 _AS(ph)PATQPPPLLPPSATGPDATVGGPAPTPLLPPSATASVK_
KHDRBS1 Ubiquitylation K165 -0.612 0.332 _VLIPVK(gl)QYPK_
KHDRBS1 Ubiquitylation K169 -0.739 0.728 _QYPK(gl)FNFVGK_
KHDRBS1 Ubiquitylation K185 0.103 0.578 _ILGPQGNTIK(gl)R_
KHDRBS1 Ubiquitylation K194 0.511 _LQEETGAK(gl)ISVLGK_
KHDRBS1 Ubiquitylation K432 -1.686 _APPARPVK(gl)GAYR_
LDB1 Ubiquitylation K76 -0.052 _IFELNK(gl)R_
LDB1 Ubiquitylation K271 -0.154 _DCLK(gl)TCLFQK_
LDB1 Ubiquitylation K277 -1.611 -0.630 _TCLFQK(gl)WQR_
LDB1 Phosphorylation S323 -0.402 -0.031 _KS(ph)PASTFALSSQVPDVMVVGEPTLMGGEFGDEDER_
LEF1 Ubiquitylation K88 -0.867 -0.222 _ESLEEAAK(gl)R_
LIMD1 Phosphorylation S314 -0.499 -0.597 _S(ph)NSGLGGEVSGVMSKPNVDPQPWFQDGPK_
LIMD1 Phosphorylation S316 -0.121 -0.506 _SNS(ph)GLGGEVSGVM(ox)SKPNVDPQPWFQDGPK_
LIMD1 Phosphorylation S384 0.174 0.127 _LS(ph)PTSLVHPVMSTLPELSCK_
LRRFIP1 Phosphorylation S16 1.105 0.905 _EIDCLS(ph)PEAQK_
LRRFIP1 Phosphorylation T114 0.965 _NMPGLSAATLASLGGT(ph)SSR_
LRRFIP1 Phosphorylation S115 1.472 _NMPGLSAATLASLGGTS(ph)SR_
LRRFIP1 Phosphorylation S116 -0.339 -0.006 _NMPGLSAATLASLGGTSS(ph)R_
LRRFIP1 Phosphorylation T711 -0.709 _IDGAT(ph)QSSPAEPK_
LRRFIP1 Phosphorylation S713 -0.143 _IDGATQS(ph)SPAEPK_
LRRFIP1 Phosphorylation S714 -0.740 _IDGATQSS(ph)PAEPK_
LRRFIP1 Phosphorylation S733 -0.146 -0.380 _CTLPEHES(ph)PSQDISDACEAESTER_
LRRFIP1 Phosphorylation S735 -0.341 0.147 _CTLPEHESPS(ph)QDISDACEAESTER_
MBD1 Ubiquitylation K110 0.094 _AHPVAVASK(gl)K_
MBD1 Ubiquitylation K111 0.094 _AHPVAVASK(gl)K_
MBD1 Phosphorylation S362 -0.412 -0.135 _ALAPS(ph)PPAEFIYYCVDEDELQPYTNRR_
MBD1 Ubiquitylation K434 0.418 _QCLQFAMK(gl)R_
MBD1 Phosphorylation T621 -0.248 _LAPEEEAGGAGT(ph)PVITEIFSLGGTR_
MBD2 Ubiquitylation K185 0.919 _SDVYYFSPSGK(gl)K_
MDFIC Phosphorylation T15 3.004 _PQRVAEAGGGQLGS(ph)T(ph)AQGK_
MDFIC Ubiquitylation K95 0.575 -0.592 _LPQLQTSAQVPSGEEIGK(gl)IK_
MDFIC Ubiquitylation K97 0.102 _LPQLQTSAQVPSGEEIGKIK(gl)_
MDFIC Ubiquitylation K130 -0.043 0.429 _LSAPVSQK(gl)MHR_
MDM2 Phosphorylation S166 0.576 1.068 _AIS(ph)ETEENSDELSGER_
MDM2 Ubiquitylation K334 -0.872 _ENWLPEDK(gl)GK_
MDM2 Ubiquitylation K336 -0.872 _ENWLPEDK(gl)GK_
MDM2 Ubiquitylation K363 0.883 _LENSTQAEEGFDVPDCK(gl)K_
MDM2 Ubiquitylation K364 0.883 _LENSTQAEEGFDVPDCK(gl)K_
MDM2 Ubiquitylation K473 0.806 _NK(gl)PCPVCR_
MECOM Phosphorylation S62 -1.041 -0.744 _EGS(ph)PYKAPIYIPDDIPIPAEFELR_
MECOM Phosphorylation S1039 -0.074 0.136 _NFIGNSNHGSQS(ph)PR_
MEN1 Ubiquitylation K8 -1.132 0.088 _AAQK(gl)TLFPLR_
MEN1 Phosphorylation S218 -0.820 _RES(ph)KPEEPPPPK_
MLX Phosphorylation S7 0.036 -0.288 _(ac)TEPGAS(ph)PEDPWVK_
MLX Ubiquitylation K173 -1.900 0.566 _LSK(gl)AIVLQK_
MLX Ubiquitylation K209 0.448 _DVTALK(gl)IMK_
MND1 Ubiquitylation K190 0.643 _FGFEENK(gl)IDR_
MPHOSPH8 Phosphorylation S51 0.647 0.507 _GAEAFGDS(ph)EEDGEDVFEVEK_
MPHOSPH8 Phosphorylation S85 1.839 _GYTS(ph)DDDTWEPEIHLEDCK_
MPHOSPH8 Phosphorylation S319 0.466 _AGQDMGLEHGFEKPLDSAMS(ph)AEEDTDVR_
MPHOSPH8 Phosphorylation S403 0.718 _GLWSTDS(ph)AEEDKETK_
MPHOSPH8 Ubiquitylation K623 0.189 _LLITK(gl)GAK_
MSX1 Phosphorylation S154 0.148 _RLS(ph)PPACTLR_
MSX2 Phosphorylation S3 -1.986 -1.774 _(ac)AS(ph)PSKGNDLFSPDEEGPAVVAGPGPGPGGAEGAAEER_
MSX2 Phosphorylation S5 -1.986 _AS(ph)PS(ph)KGNDLFSPDEEGPAVVAGPGPGPGGAEGAAEER_
MSX2 Phosphorylation S63 3.351 _EAS(ph)PLPAESASAGATLRPLLLSGHGAR_
MSX2 Phosphorylation S91 -0.783 -0.727 _EAHS(ph)PGPLVKPFETASVK_
MSX2 Phosphorylation S123 -0.062 _SENSEDGAAWMQEPGRYS(ph)PPPR_
MTA2 Ubiquitylation K32 0.007 _RIEELNK(gl)TANGNVEAK_
MTA2 Phosphorylation S54 0.469 0.399 _DISSS(ph)LNSLADSNAR_
MTA2 Ubiquitylation K71 0.012 _EFEEESK(gl)QPGVSEQQR_
MTA2 Ubiquitylation K152 0.194 0.043 _VGCK(gl)YQAEIPDRLVEGESDNR_
MTA2 Ubiquitylation K173 -0.127 _LVEGESDNRNQQK(gl)MEMK_
MTA2 Ubiquitylation K177 -0.885 _MEMK(gl)VWDPDNPLTDR_
MTA2 Ubiquitylation K320 0.565 _TTDRYIQQK(gl)R_
MTA2 Ubiquitylation K405 -0.377 _YGGLK(gl)TPTQLEGATR_
MTA2 Phosphorylation S435 -0.289 _GHLSRPEAQSLS(ph)PYTTSANR_
MTA2 Ubiquitylation K508 -0.512 _TPLK(gl)IHPLVR_
MTA2 Ubiquitylation K531 -0.796 _DLVAQAPLK(gl)PK_
MTA2 Phosphorylation T534 -0.765 _DLVAQAPLKPKT(ph)PR_
MTA2 Ubiquitylation K559 0.516 _GLGGIMVK(gl)R_
MTA2 Ubiquitylation K611 -1.680 _LNPADAPNPVVFVATK(gl)DTR_
MXD3 Ubiquitylation K81 -0.016 _LK(gl)QQMPLGADCAR_
MXD4 Ubiquitylation K99 -0.274 _TK(gl)AAGLVR_
MXD4 Ubiquitylation K152 1.246 _HTTLSLLK(gl)R_
MXD4 Ubiquitylation K172 0.992 _ALSIK(gl)EQLQQEHR_
MYBBP1A Phosphorylation S11 -0.422 -0.302 _DPAQPMS(ph)PGEATQSGAR_
MYBBP1A Ubiquitylation K277 -0.877 _LALK(gl)EDKFPR_
MYBBP1A Ubiquitylation K866 0.520 0.144 _SSSSK(gl)QEQDLLHK_
MYBBP1A Ubiquitylation K988 1.042 _VYSTALSSFLTK(gl)R_
MYBBP1A Phosphorylation T1161 -0.711 _EIPSAT(ph)QSPISKK_
MYBBP1A Phosphorylation S1163 -0.890 -0.454 _EIPSATQS(ph)PISK_
MYBBP1A Phosphorylation S1267 -0.576 -0.493 _NQKPSQVNGAPGS(ph)PTEPAGQK_
MYBBP1A Phosphorylation S1290 0.131 _KGVLGKS(ph)PLSALAR_
MYBBP1A Phosphorylation S1308 -0.851 _LSLVIRS(ph)PSLLQSGAK_
MYBBP1A Phosphorylation S1314 3.386 _SPSLLQS(ph)GAK_
NAB2 Phosphorylation S6 -1.285 -0.988 _APS(ph)PTAEQPPGGGDSAR_
NAB2 Phosphorylation S171 -1.100 _SPLELGEKLS(ph)PLPGGPGAGDPR_
NACC1 Phosphorylation S145 -0.773 _VSSPSCDSQGLHAEEAPSSEPQS(ph)PVAQTSGWPACSTPLPLVSR_
NCOA2 Phosphorylation S699 -0.159 -0.104 _LLQDSSS(ph)PVDLAK_
NCOA2 Phosphorylation S771 1.654 0.621 _LDS(ph)KTDPASNTK_
NCOR1 Phosphorylation S1195 -0.029 0.716 _MPIEDS(ph)SPEKGREEAASK_
NCOR1 Phosphorylation S1196 0.087 0.141 _MPIEDSS(ph)PEKGR_
NCOR1 Phosphorylation S1472 0.700 0.536 _AQLS(ph)PGIYDDTSAR_
NCOR1 Phosphorylation S1977 -0.959 -0.974 _YETPSDAIEVIS(ph)PASSPAPPQEK_
NCOR1 Ubiquitylation K1998 -2.086 _LQTYQPEVVK(gl)ANQAENDPTR_
NCOR1 Phosphorylation S2120 0.148 0.154 _VS(ph)PENLVDK_
NCOR1 Phosphorylation S2151 -1.006 -0.922 _SHVSSEPYEPIS(ph)PPQVPVVHEK_
NCOR1 Phosphorylation S2184 0.120 0.226 _S(ph)PGSISYLPSFFTK_
NCOR1 Phosphorylation S2187 0.396 _SPGS(ph)ISYLPSFFTK_
NCOR2 Phosphorylation S939 -0.637 _LLS(ph)PRPSLLTPTGDPR_
NCOR2 Phosphorylation S943 -0.740 _LLSPRPS(ph)LLTPTGDPR_
NCOR2 Phosphorylation S956 -0.223 -0.308 _ANAS(ph)PQKPLDLK_
NCOR2 Phosphorylation S1023 -0.334 _S(ph)RSPAPPADKEAFAAEAQK_
NCOR2 Phosphorylation S1025 1.950 _SRS(ph)PAPPADKEAFAAEAQK_
NCOR2 Phosphorylation T1383 -1.746 -2.157 _EGT(ph)PPPPPPSR_
NCOR2 Phosphorylation S1479 0.325 -0.132 _SLIGS(ph)PGR_
NCOR2 Phosphorylation S1778 -0.687 _HSSSPLS(ph)PGGPTHLTKPTTTSSSER_
NCOR2 Phosphorylation S1970 -0.321 _SGLEPAS(ph)SPSK_
NCOR2 Phosphorylation S1971 -0.480 _SGLEPASS(ph)PSK_
NCOR2 Phosphorylation S2223 -0.074 -1.140 _TSVLGGGEDGIEPVS(ph)PPEGMTEPGHSR_
NCOR2 Phosphorylation S2258 -0.573 -0.210 _S(ph)PGNTSQPPAFFSK_
NCOR2 Phosphorylation S2413 0.973 _AKS(ph)PAPGLASGDRPPSVSSVHSEGDCNR_
NDUFA13 Ubiquitylation K22 -2.069 _VKQDMPPPGGYGPIDYK(gl)R_
NDUFA13 Ubiquitylation K105 -1.894 _DVPDWK(gl)VGESVFHTTR_
NELFB Ubiquitylation K85 0.958 -1.303 _VSAIASEGK(gl)AEER_
NELFB Ubiquitylation K146 -0.603 _ACAVEVK(gl)R_
NELFB Ubiquitylation K519 -1.238 _VAPSK(gl)LEALQK_
NELFB Phosphorylation S557 -2.020 -1.963 _KPS(ph)PAQAAETPALELPLPSVPAPAPL_
NELFCD Ubiquitylation K393 -0.620 -0.679 _VSINKDELK(gl)STSK_
NFIC Phosphorylation S294 -0.140 -0.153 _SGSMEEDVDTS(ph)PGGDYYTSPS(ph)SPTSSSR_
NFIC Phosphorylation S294 -1.873 _TISIDENM(ox)EPSPTGDFYPSPS(ph)SPAAGSR_
NFIC Phosphorylation S295 -1.280 _TISIDENMEPSPTGDFYPSPSS(ph)PAAGSR_
NFIC Phosphorylation S300 -1.728 _TISIDENM(ox)EPSPTGDFYPSPSSPAAGS(ph)R_
NFIC Phosphorylation S304 -0.547 -0.146 _SGSMEEDVDTSPGGDYYTSPS(ph)SPTSSSR_
NFIC Phosphorylation S305 -0.748 -0.199 _SGSMEEDVDTSPGGDY(ph)YTSPSS(ph)PTSSSR_
NFIC Phosphorylation S311 1.021 0.671 _DQDMS(ph)SPTTM(ox)K_
NFIC Phosphorylation S312 0.764 0.746 _DQDMSS(ph)PTTMK_
NFIC Phosphorylation T314 0.827 _DQDMSSPT(ph)TMK_
NFIC Phosphorylation S322 0.191 0.020 _NWTEDMEGGIS(ph)SPVKK_
NFIC Phosphorylation S323 0.317 0.328 _NWTEDM(ox)EGGISS(ph)PVKK_
NFIC Phosphorylation S325 0.852 _KPEKPLFS(ph)SASPQDSSPR_
NFIC Phosphorylation S328 1.295 0.637 _KPEKPLFSSAS(ph)PQDSSPR_
NFIC Phosphorylation S332 -0.428 -1.102 _KPEKPLFSSASPQDS(ph)SPR_
NFIC Phosphorylation S333 0.309 -0.312 _TEMDKS(ph)PFNSPSPQDSPR_
NFIC Phosphorylation S333 -0.428 _KPEKPLFSSASPQDS(ph)SPR_
NFIC Phosphorylation S339 -1.705 -1.357 _SPFNSPS(ph)PQDSPR_
NFKB1 Phosphorylation S907 -0.025 0.113 _TTSQAHSLPLS(ph)PASTR_
NIPBL Phosphorylation S178 0.767 1.039 _NNTAAETEDDES(ph)DGEDRGGGTSGVR_
NIPBL Phosphorylation S280 0.496 0.816 _SPQPVCS(ph)PAGSEGTPK_
NIPBL Phosphorylation S284 0.172 0.245 _SPQPVCSPAGS(ph)EGTPK_
NIPBL Phosphorylation S305 0.703 _GSRPPLILQSQSLPCS(ph)SPR_
NIPBL Phosphorylation S306 0.689 0.413 _GSRPPLILQSQSLPCSS(ph)PR_
NIPBL Phosphorylation S318 -0.415 -0.625 _DVPPDILLDS(ph)PERK_
NIPBL Phosphorylation S349 0.713 0.649 _AAMYDIIS(ph)SPSKDSTK_
NIPBL Phosphorylation S350 0.226 0.375 _AAMYDIISS(ph)PSK_
NIPBL Phosphorylation S553 2.102 1.878 _VDS(ph)QASITQDSDSIK_
NIPBL Phosphorylation T599 0.308 _STPENHPET(ph)PKKK_
NIPBL Phosphorylation T713 -0.940 -0.779 _GESRPET(ph)PKQK_
NIPBL Ubiquitylation K1628 0.366 _DAVTSK(gl)MDQGSIER_
NIPBL Phosphorylation S2658 0.412 0.260 _AITSLLGGGS(ph)PK_
NIPBL Phosphorylation S2672 0.868 _NNTAAETEDDES(ph)DGEDRGGGTSGSLR_
NKAP Phosphorylation S9 0.004 _APVSGSRS(ph)PDREASGSGGR_
NKAP Phosphorylation S64 2.600 _NGLTHQLGGLS(ph)QGSR_
NKAP Phosphorylation S149 -0.075 -0.248 _IGELGAPEVWGLS(ph)PK_
NKAP Ubiquitylation K379 0.022 _ENQIYSADEK(gl)R_
NR1D2 Ubiquitylation K467 0.879 _TVTFLSGK(gl)K_
NR2C1 Phosphorylation S215 1.203 0.766 _DLRS(ph)PLTATPTFVTDSESTR_
NR2C1 Phosphorylation T218 1.210 1.399 _DLRSPLT(ph)ATPTFVTDSESTR_
NR2F2 Ubiquitylation K362 0.144 _FGK(gl)LLLR_
NR2F2 Ubiquitylation K389 -0.473 -0.156 _LVGK(gl)TPIETLIR_
PA2G4 Phosphorylation S2 0.682 0.779 _S(ph)GEDEQQEQTIAEDLVVTK_
PA2G4 Phosphorylation T11 0.587 0.951 _S(ph)GEDEQQEQT(ph)IAEDLVVTK_
PA2G4 Ubiquitylation K51 1.374 _YK(gl)MGGDIANR_
PA2G4 Ubiquitylation K277 0.023 -0.053 _TTIYK(gl)RDPSK_
PA2G4 Ubiquitylation K282 -0.045 0.559 _DPSK(gl)QYGLK_
PA2G4 Ubiquitylation K287 0.472 _QYGLK(gl)MK_
PA2G4 Phosphorylation S360 0.161 0.753 _ALLQS(ph)SASR_
PBXIP1 Phosphorylation S3 0.778 _(ac)AS(ph)CPDSDNSWVLAGSESLPVETLGPASR_
PBXIP1 Phosphorylation S43 0.608 0.616 _ALQAPHS(ph)PSKTDGK_
PCGF6 Phosphorylation S115 1.032 0.880 _LEGGRQDS(ph)EDEEER_
PCGF6 Ubiquitylation K234 -2.981 -2.972 _GLEVPKPAVPQPVPSSK(gl)GR_
PDCD4 Phosphorylation S76 1.091 0.816 _GDS(ph)VSDSGSDALR_
PDCD4 Phosphorylation T93 -0.214 0.036 _SGLTVPT(ph)SPK_
PDCD4 Phosphorylation S94 -0.407 -0.022 _SGLTVPTS(ph)PK_
PDCD4 Ubiquitylation K242 1.242 _SFDK(gl)LLK_
PDCD4 Ubiquitylation K245 -0.529 _LLK(gl)DLPELALDTPR_
PDCD4 Ubiquitylation K309 1.505 _ATVLLSMSKGGK(gl)_
PDCD4 Phosphorylation S457 0.751 0.699 _RFVS(ph)EGDGGR_
PER1 Ubiquitylation K295 -1.272 _DFTQEK(gl)SVFCR_
PEX14 Phosphorylation S232 1.626 _RQFPPS(ph)PSAPK_
PEX14 Phosphorylation S234 3.951 _RQFPPSPS(ph)APK_
PFDN5 Ubiquitylation K42 0.746 _VVQTK(gl)YVEAK_
PFDN5 Ubiquitylation K55 0.014 0.436 _DCLNVLNK(gl)SNEGK_
PFDN5 Ubiquitylation K104 0.185 0.595 _TAEDAKDFFK(gl)R_
PFDN5 Ubiquitylation K112 -0.336 _KIDFLTK(gl)QMEK_
PFDN5 Ubiquitylation K153 -0.155 0.828 _IQQLTALGAAQATAK(gl)A_
PHB Ubiquitylation K83 -0.521 _NVPVITGSK(gl)DLQNVNITLR_
PHB Ubiquitylation K186 -0.124 _EFTEAVEAK(gl)QVAQQEAER_
PHB Ubiquitylation K202 0.125 _FVVEK(gl)AEQQKK_
PHF12 Phosphorylation T129 5.544 _RT(ph)T(ph)SPS(ph)SDTDLLDRS(ph)ASK_
PHF12 Phosphorylation T130 5.544 _RT(ph)T(ph)SPS(ph)SDTDLLDRS(ph)ASK_
PHF12 Phosphorylation S131 0.403 0.428 _TTS(ph)PSSDTDLLDR_
PHF12 Phosphorylation S133 5.544 _RT(ph)T(ph)SPS(ph)SDTDLLDRS(ph)ASK_
PHF12 Phosphorylation S142 5.544 _RT(ph)T(ph)SPS(ph)SDTDLLDRS(ph)ASK_
PHF12 Phosphorylation T671 -0.003 -0.158 _VLT(ph)PPQAAGDGILATTANQR_
PHF12 Phosphorylation S977 0.955 0.941 _GDAS(ph)LLQDGVLAEK_
PIAS4 Ubiquitylation K57 0.068 -0.936 _ALQLVQFDCSPELFKK(gl)_
PIAS4 Ubiquitylation K125 -2.654 _LPAK(gl)TLKPEVR_
PIAS4 Ubiquitylation K330 -1.699 _VSLICPLVK(gl)MR_
PLCB1 Phosphorylation S1199 -0.494 _TPS(ph)SEELGGDIPGKEFDTPL_
PLCB1 Phosphorylation S1200 -0.483 _TPSS(ph)EELGGDIPGKEFDTPL_
PML Ubiquitylation K394 0.515 0.360 _LQDLSSCITQGK(gl)DAAVSKK_
PML Phosphorylation S403 3.141 _KAS(ph)PEAASTPRDPIDVDLPEEAER_
PML Ubiquitylation K476 -0.403 -0.735 _GPSYGEDVSNTTTAQK(gl)R_
PML Phosphorylation S504 -0.198 -0.109 _S(ph)SPEQPRPSTSK_
PML Phosphorylation S505 -0.198 -0.109 _S(ph)SPEQPRPSTSK_
PML Phosphorylation S518 -1.632 -1.605 _AVS(ph)PPHLDGPPS(ph)PR_
PML Phosphorylation S527 -1.392 -1.605 _AVS(ph)PPHLDGPPS(ph)PR_
PML Phosphorylation S530 0.466 0.093 _S(ph)PVIGSEVFLPNSNHVASGAGEAEER_
PML Ubiquitylation K623 -0.784 _IDNETQK(gl)ISQLAAVNR_
POU2F1 Phosphorylation S8 1.971 2.219 _(ac)ADGGAAS(ph)QDESSAAAAAAADSR_
POU2F1 Phosphorylation S408 0.932 1.562 _RTS(ph)IETNIR_
POU2F1 Phosphorylation S471 -0.483 -0.496 _RINPPSSGGTSSS(ph)PIK_
POU3F3 Ubiquitylation K377 0.051 -0.035 _LK(gl)PLLNK_
PPARGC1B Phosphorylation S524 0.617 _ELGS(ph)PTDEDSGQDQQLLR_
PRAME Ubiquitylation K157 -2.418 _ASLYSFPEPEAAQPMTK(gl)K_
PRAME Ubiquitylation K158 -2.418 _ASLYSFPEPEAAQPMTK(gl)K_
PRDM16 Phosphorylation S62 -1.041 -0.744 _EGS(ph)PYKAPIYIPDDIPIPAEFELR_
PRDM16 Phosphorylation S1039 -0.074 0.136 _NFIGNSNHGSQS(ph)PR_
PRDM6 Phosphorylation S68 0.643 0.662 _AEPPPDS(ph)LRPR_
PRMT6 Phosphorylation T21 0.891 0.194 _LESGGGGEGGEGT(ph)EEEDGAER_
PROX1 Phosphorylation S511 0.460 0.502 _DRAS(ph)PESLDLTR_
PSMC5 Ubiquitylation K7 0.167 _(ac)MELEEGK(gl)AGSGLR_
PSMC5 Ubiquitylation K15 -0.747 0.003 _(ac)ALDGPEQMELEEGK(gl)AGSGLR_
PSMC5 Ubiquitylation K55 -0.538 -0.039 _NELNAK(gl)VR_
PSMC5 Ubiquitylation K88 -0.430 -0.397 _VLVK(gl)VHPEGK_
PSMC5 Ubiquitylation K101 -1.062 _FVVDVDK(gl)NIDINDVTPNCR_
PSMC5 Ubiquitylation K130 -0.243 _ILPNK(gl)VDPLVSLMMVEK_
PSMC5 Ubiquitylation K330 2.949 _LDILK(gl)IHSR_
PSMC5 Ubiquitylation K346 0.008 _K(gl)IAELMPGASGAEVK_
PSMC5 Ubiquitylation K397 0.415 0.779 _DSEK(gl)NMSIK_
PSMC5 Ubiquitylation K402 0.363 _DSEK(gl)NMSIKK_
PURA Ubiquitylation K97 0.301 _IAEVGAGGNK(gl)SR_
PURB Phosphorylation S6 -0.526 0.688 _(ac)ADGDS(ph)GSERGGGGGPCGFQPASR_
PURB Phosphorylation S8 0.527 _(ac)ADGDSGS(ph)ERGGGGGPCGFQPASR_
PURB Ubiquitylation K70 1.141 _IAEVGAGGSK(gl)SR_
PURB Phosphorylation S100 0.095 0.006 _DSLGDFIEHYAQLGPS(ph)SPEQLAAGAEEGGGPR_
PURB Phosphorylation S101 -0.621 -0.506 _DSLGDFIEHYAQLGPSS(ph)PEQLAAGAEEGGGPR_
PURB Phosphorylation S304 0.666 0.610 _RGGGSGGGEES(ph)EGEEVDED_
RB1 Phosphorylation S69 -3.602 -3.397 _TAATAAAAAAEPPAPPPPPPPEEDPEQDS(ph)GPEDLPLVR_
RB1 Ubiquitylation K97 -0.546 _LK(gl)IPDHVR_
RB1 Phosphorylation T388 0.005 0.116 _TLQTDSIDSFETQRT(ph)PR_
RB1 Phosphorylation T405 -0.851 -0.901 _KSNLDEEVNVIPPHT(ph)PVR_
RB1 Phosphorylation S820 -0.019 _S(ph)PYKFPSSPLR_
RB1 Ubiquitylation K823 -2.214 _SPYK(gl)FPSSPLR_
RB1 Phosphorylation S827 0.824 0.111 _FPSS(ph)PLR_
RB1 Phosphorylation S839 -0.701 -1.045 _IPGGNIYIS(ph)PLKS(ph)PYK_
RB1 Ubiquitylation K842 -0.751 _IPGGNIYISPLK(gl)SPYK_
RB1 Phosphorylation S843 -0.701 -0.022 _IPGGNIYIS(ph)PLKS(ph)PYK_
RB1 Ubiquitylation K846 -2.084 _SPYK(gl)ISEGLPTPTK_
RB1 Phosphorylation T853 0.039 -0.555 _ISEGLPT(ph)PTKM(ox)T(ph)PR_
RB1 Ubiquitylation K856 -1.350 _ISEGLPTPTK(gl)MTPR_
RB1 Phosphorylation T858 -0.782 0.564 _ISEGLPT(ph)PTKMT(ph)PR_
RB1 Ubiquitylation K879 -0.187 _FQK(gl)INQMVCNSDR_
RBBP7 Phosphorylation S3 1.036 1.447 _(ac)AS(ph)KEMFEDTVEER_
RBBP7 Ubiquitylation K4 0.122 -0.804 _(ac)ASK(gl)EMFEDTVEER_
RBBP7 Ubiquitylation K21 0.081 -0.004 _VINEEYK(gl)IWK_
RBBP7 Phosphorylation S145 0.319 1.248 _TPS(ph)SDVLVFDYTK_
RBBP7 Ubiquitylation K159 -1.249 -3.808 _HPAK(gl)PDPSGECNPDLR_
RBBP7 Ubiquitylation K214 -0.021 _EGK(gl)IVDAK_
RBBP7 Ubiquitylation K236 0.469 _DSSVK(gl)LYQTR_
RCOR1 Phosphorylation S124 0.641 _S(ph)QERDNLGMLVWSPNQNLSEAK_
RCOR1 Ubiquitylation K156 1.766 _LDEYIAIAKEK(gl)_
RCOR1 Phosphorylation S257 -0.356 _REREES(ph)EDELEEANGNNPIDIEVDQNK_
RCOR2 Phosphorylation S63 0.022 -0.266 _VGTNYQAVIPECKPES(ph)PAR_
RCOR2 Phosphorylation S124 0.641 _S(ph)QERDNLGMLVWSPNQNLSEAK_
RCOR2 Ubiquitylation K156 1.766 _LDEYIAIAKEK(gl)_
RCOR2 Phosphorylation S213 -0.586 -0.539 _GGVS(ph)EGEPDPADPK_
RCOR2 Phosphorylation S257 -0.356 _REREES(ph)EDELEEANGNNPIDIEVDQNK_
REST Ubiquitylation K280 0.406 _VYTCGK(gl)CNYFSDR_
REST Phosphorylation S864 -3.456 _ESVSTEDLSPPS(ph)PPLPK_
RFC1 Phosphorylation S156 -0.050 0.188 _NKPLS(ph)PIK_
RFC1 Phosphorylation T161 2.131 1.586 _NKPLS(ph)PIKLT(ph)PTSVLDYFGTGSVQR_
RFC1 Phosphorylation T163 1.551 _NKPLS(ph)PIKLTPT(ph)SVLDYFGTGSVQR_
RFC1 Phosphorylation S190 2.756 2.241 _ELS(ph)QNTDESGLNDEAIAK_
RFC1 Ubiquitylation K240 0.991 _TLAMLDEEPKTKK(gl)_
RFC1 Ubiquitylation K271 0.551 _VK(gl)TAQVSDERK_
RFC1 Phosphorylation S368 0.431 0.440 _KESVS(ph)PEDSEK_
RFC1 Ubiquitylation K436 -0.227 _YGGK(gl)VTGNVSK_
RFC1 Ubiquitylation K498 0.781 _SKYEIAVETEMK(gl)K_
RFC1 Ubiquitylation K499 0.781 _SKYEIAVETEMK(gl)K_
RFX3 Phosphorylation S155 -0.079 0.160 _AS(ph)PATIEMAIETLQK_
RFX3 Phosphorylation T164 0.082 -0.152 _PGHVSPLQLT(ph)NIQVPQQALPTQR_
RLIM Phosphorylation S228 -0.682 -0.653 _S(ph)RSPLHPM(ox)SEIPR_
RLIM Phosphorylation S230 -0.901 -0.673 _SRS(ph)PLHPM(ox)SEIPR_
RLIM Ubiquitylation K550 -0.777 -0.113 _GLTK(gl)EQIDNLAMR_
RLIM Ubiquitylation K582 -0.004 -0.263 _TCSVCITEYTEGNK(gl)LR_
RREB1 Phosphorylation S161 -0.718 -0.899 _IHEKDPNSATATAPPS(ph)PLK_
RREB1 Ubiquitylation K763 -1.253 _LCGEDLK(gl)HYR_
RREB1 Phosphorylation T1116 -0.250 _AATTAT(ph)PAATTSPK_
RREB1 Phosphorylation S1167 0.831 0.515 _ANS(ph)GGVDLDSSGEFASIEK_
RREB1 Phosphorylation S1219 -1.622 _FSPFLQTAEDNTQDEVAGAPADHHGPS(ph)DEEQGSPPEDK_
RREB1 Phosphorylation S1320 -0.037 0.000 _QVAGDAPVEQATAETAS(ph)PVHR_
RREB1 Phosphorylation S1653 -1.287 -1.742 _VTAGWPSEPGQGDLNPES(ph)PAALGQDLLEPR_
RSF1 Ubiquitylation K136 0.337 _YLCECQFDDNLK(gl)FK_
RSF1 Ubiquitylation K215 -2.531 0.017 _AQIDPVLLK(gl)NSSQQDNSSR_
RSF1 Phosphorylation S397 -0.655 -0.787 _LSDDFDS(ph)PVKGPLCK_
RSF1 Phosphorylation T408 1.744 2.000 _SVT(ph)PTKEFLKDEIK_
RSF1 Phosphorylation S471 0.625 _FYETKEES(ph)YSPSKDR_
RSF1 Phosphorylation S473 0.736 0.445 _EESYS(ph)PSKDR_
RSF1 Phosphorylation S475 1.316 _FYETKEESYSPS(ph)KDR_
RSF1 Phosphorylation S604 -0.084 -0.114 _TFLDKDAQRLS(ph)PIPEEVPK_
RSF1 Phosphorylation S617 -0.681 -0.594 _STLES(ph)EKPGSPEAAETSPPSNIIDHCEK_
RSF1 Phosphorylation S622 -0.537 -0.508 _STLESEKPGS(ph)PEAAETSPPSNIIDHCEK_
RSF1 Phosphorylation S748 -0.792 -0.682 _KPDS(ph)PPKVLEPENK_
RSF1 Phosphorylation T1305 -0.092 0.111 _IET(ph)DEEESCDNAHGDANQPAR_
RSF1 Phosphorylation S1345 0.586 0.555 _IES(ph)DEEEDFENVGK_
RSF1 Phosphorylation S1359 -0.333 _VGS(ph)PLDYSLVDLPSTNGQS(ph)PGK_
RSF1 Phosphorylation S1375 -0.333 _VGS(ph)PLDYSLVDLPSTNGQS(ph)PGK_
RUNX2 Phosphorylation S96 0.504 -0.399 _RFS(ph)PPSSSLQPGK_
RUNX2 Ubiquitylation K244 0.258 _NASAVMK(gl)NQVAR_
SALL1 Phosphorylation S1119 -1.156 -1.235 _DTPTSHVPSGPLSSSATS(ph)PVLLPALPR_
SALL2 Ubiquitylation K515 -1.115 _FVLMK(gl)AVEPK_
SALL2 Ubiquitylation K522 -1.318 -1.842 _NK(gl)ADENTPPGSEGSAISGVAESSTATR_
SALL2 Ubiquitylation K598 0.186 -0.445 _LQQLVEK(gl)IDR_
SALL2 Phosphorylation S802 0.187 0.081 _GDS(ph)EEASGAEEEVGTVAAAATAGK_
SALL2 Phosphorylation S806 0.101 0.212 _GDSEEAS(ph)GAEEEVGTVAAAATAGK_
SALL2 Phosphorylation S1119 -1.156 -1.235 _DTPTSHVPSGPLSSSATS(ph)PVLLPALPR_
SBNO2 Ubiquitylation K1011 0.417 _FASIVAK(gl)R_
SET Phosphorylation S5 0.974 1.416 _(ac)M(ox)PRS(ph)HQPPPPPHEKEQQEAIEHIDEVQNEIDR_
SET Phosphorylation S7 -0.663 -0.220 _RQS(ph)PLPPQK_
SET Phosphorylation S50 0.839 0.970 _LNEQAS(ph)EEILK_
SET Ubiquitylation K68 0.085 0.780 _LNEQASEEILK(gl)VEQK_
SET Ubiquitylation K83 -0.051 0.259 _QPFFQK(gl)R_
SET Ubiquitylation K132 0.135 1.415 _VEVTEFEDIK(gl)SGYR_
SET Ubiquitylation K154 0.022 0.406 _VLSK(gl)EFHLNESGDPSSK_
SET Ubiquitylation K167 -0.264 -0.069 _EFHLNESGDPSSK(gl)STEIK_
SET Ubiquitylation K172 -0.135 0.904 _STEIK(gl)WK_
SETD8 Ubiquitylation K234 2.165 _K(gl)SKAELQSEER_
SETD8 Ubiquitylation K236 -1.450 2.341 _SK(gl)AELQSEER_
SETD8 Ubiquitylation K267 2.000 _IDLIDGK(gl)GR_
SETD8 Ubiquitylation K275 2.687 _GVIATK(gl)QFSR_
SETD8 Ubiquitylation K342 1.991 _LINHSK(gl)CGNCQTK_
SIM2 Ubiquitylation K51 -0.897 _LTTSYLK(gl)MR_
SIN3A Ubiquitylation K155 0.182 _EFK(gl)SQSIDTPGVISR_
SIN3A Phosphorylation T266 -0.572 _VSKPSQLQAHTPASQQT(ph)PPLPPYASPR_
SIN3A Phosphorylation S277 -1.598 _S(ph)PPVQPHTPVTISLGTAPSLQNNQPVEFNHAINYVNK_
SIN3A Phosphorylation S295 -1.959 _SPPVQPHTPVTISLGTAPS(ph)LQNNQPVEFNHAINYVNK_
SIN3A Ubiquitylation K638 -0.223 _VLEAIQK(gl)K_
SIN3A Ubiquitylation K639 -0.223 _VLEAIQK(gl)K_
SIN3A Ubiquitylation K715 1.012 _GFNK(gl)VWR_
SIN3A Phosphorylation S832 0.764 0.363 _GDLS(ph)DVEEEEEEEM(ox)DVDEATGAVKK_
SIN3A Ubiquitylation K875 0.131 0.003 _LLFSNTAAQK(gl)LR_
SIN3A Ubiquitylation K937 -0.224 -0.025 _DK(gl)SDSPAIQLR_
SIN3A Phosphorylation S940 -0.107 _DKSDS(ph)PAIQLR_
SIN3A Phosphorylation T1111 0.691 0.517 _YM(ox)NSDTT(ph)SPELR_
SIN3A Phosphorylation S1112 0.623 0.725 _YM(ox)NSDTTS(ph)PELR_
SIN3B Phosphorylation S1003 0.432 _YVEQYVGTEGASSS(ph)PTEGFLLKPVFLQR_
SIRT1 Phosphorylation S14 -0.369 -0.246 _(ac)ADEAALALQPGGS(ph)PSAAGADR_
SIRT1 Phosphorylation S16 -0.306 -1.665 _(ac)ADEAALALQPGGS(ph)PS(ph)AAGADREAASSPAGEPLR_
SIRT1 Phosphorylation S26 -1.047 -0.245 _EAAS(ph)SPAGEPLR_
SIRT1 Phosphorylation S27 0.351 -0.363 _EAASS(ph)PAGEPLR_
SIRT1 Phosphorylation S47 -0.574 -0.607 _S(ph)PGEPGGAAPER_
SIRT1 Ubiquitylation K238 -1.641 _RK(gl)DINTIEDAVK_
SIRT1 Ubiquitylation K499 -2.138 -0.204 _LGGEYAK(gl)LCCNPVK_
SIRT1 Ubiquitylation K578 -2.782 _GCMEEK(gl)PQEVQTSR_
SIRT1 Ubiquitylation K601 -3.051 _NVESIAEQMENPDLK(gl)NVGSSTGEK_
SIRT2 Ubiquitylation K39 0.138 0.076 _NLFSQTLSLGSQK(gl)ER_
SIRT2 Ubiquitylation K140 0.154 1.067 _LLK(gl)DKGLLLR_
SIRT2 Ubiquitylation K142 0.842 1.458 _LLKDK(gl)GLLLR_
SIRT2 Ubiquitylation K270 -0.520 _LLINK(gl)EK_
SIRT2 Phosphorylation S364 -0.719 _EHASIDAQSGAGVPNPS(ph)TSASPK_
SIRT2 Phosphorylation S366 -0.826 _EHASIDAQSGAGVPNPSTS(ph)ASPK_
SIRT2 Phosphorylation S368 -0.366 -0.702 _EHASIDAQSGAGVPNPSTSAS(ph)PK_
SMAD2 Phosphorylation T8 -0.896 -0.885 _(ac)SSILPFT(ph)PPVVK_
SMAD2 Ubiquitylation K13 -0.058 _(ac)SSILPFTPPVVK(gl)R_
SMARCA2 Phosphorylation S329 -0.314 -0.351 _IS(ph)PIQKPQGLDPVEILQER_
SMARCA2 Ubiquitylation K333 -1.365 _ISPIQK(gl)PQGLDPVEILQER_
SMARCA2 Ubiquitylation K381 0.558 1.360 _ATVELK(gl)ALR_
SMARCA2 Ubiquitylation K413 -0.238 _DTTLETALNSK(gl)AYKR_
SMARCA2 Phosphorylation S1377 -0.887 -1.142 _GRPPAEKLS(ph)PNPPK_
SMARCA4 Ubiquitylation K357 -0.934 _ITPIQK(gl)PR_
SMARCA4 Ubiquitylation K405 0.109 1.148 _ATIELK(gl)ALR_
SMARCA4 Ubiquitylation K437 -0.317 _DTALETALNAK(gl)AYKR_
SMARCA4 Ubiquitylation K455 0.225 _ITEK(gl)LEK_
SMARCA4 Ubiquitylation K496 0.923 _SVTGK(gl)IQK_
SMARCA4 Phosphorylation S677 -0.880 -0.324 _KAENAEGQTPAIGPDGEPLDETSQMS(ph)DLPVK_
SMARCA4 Ubiquitylation K1283 0.125 _ILAAAK(gl)YK_
SMARCA4 Phosphorylation S1413 -0.265 0.515 _EVDYSDS(ph)LTEK_
SMARCA4 Phosphorylation S1486 -0.713 -0.935 _LS(ph)PNPPNLTK_
SMARCC2 Ubiquitylation K161 -0.199 _LKDIIK(gl)R_
SMARCC2 Phosphorylation S283 0.602 0.869 _TLTDEVNS(ph)PDSDRR_
SMARCC2 Phosphorylation S302 -0.755 -0.668 _RS(ph)PSPSPTPEAK_
SMARCC2 Phosphorylation S347 -0.627 -0.862 _DMDEPS(ph)PVPNVEEVTLPK_
SMARCC2 Ubiquitylation K455 -0.775 _ALPEFFNGKNK(gl)_
SMARCC2 Ubiquitylation K694 0.389 _VASAAAK(gl)SALEEFSK_
SMARCC2 Ubiquitylation K872 -0.712 _DIGEGNLSTAAAAALAAAAVK(gl)AK_
SMARCC2 Ubiquitylation K874 0.402 _AK(gl)HLAAVEER_
SMARCC2 Ubiquitylation K902 0.641 0.460 _KLEIK(gl)LR_
SMARCE1 Ubiquitylation K92 0.706 _ASNPDLK(gl)LWEIGK_
SMARCE1 Ubiquitylation K271 -0.418 -0.010 _FLESTDSFNNELK(gl)R_
SNW1 Ubiquitylation K193 1.500 _YTPSQQGVAFNSGAK(gl)QR_
SNW1 Phosphorylation S224 -0.528 0.034 _GPPS(ph)PPAPVMHSPS(ph)RK_
SNW1 Phosphorylation S232 -1.645 -1.722 _GPPS(ph)PPAPVMHS(ph)PSR_
SNW1 Phosphorylation S234 -1.881 _GPPS(ph)PPAPVMHSPS(ph)RK_
SNX6 Ubiquitylation K119 0.721 0.619 _LGEGEGSMTK(gl)EEFTK_
SNX6 Ubiquitylation K291 0.222 _VSADEDLK(gl)LSDLLK_
SNX6 Ubiquitylation K307 0.601 _ESQAAK(gl)DLLYR_
SOX5 Phosphorylation S21 0.635 _RPAS(ph)PYGEADGEVAMVTSR_
SOX5 Phosphorylation S370 -0.512 _LPGIPQGNLGAAVS(ph)PTSIHTDK_
SOX6 Phosphorylation S98 -0.827 -0.182 _NTSTS(ph)PHKPDEGSR_
SPEN Phosphorylation S623 2.452 1.372 _RAS(ph)YDYNQDR_
SPEN Phosphorylation S727 0.569 0.583 _SQS(ph)PVHLR_
SPEN Phosphorylation S736 -1.190 -0.481 _RPQS(ph)PGAS(ph)PSQAER_
SPEN Phosphorylation S740 -0.446 _RPQS(ph)PGAS(ph)PSQAER_
SPEN Phosphorylation T1059 0.478 0.374 _LNT(ph)VASPKDCQELASISVGSGSRPSSDLQAR_
SPEN Phosphorylation S1062 0.195 0.089 _LNTVAS(ph)PKDCQELASISVGSGSRPSSDLQAR_
SPEN Phosphorylation T1140 0.280 -0.193 _NYCSLRDET(ph)PERK_
SPEN Phosphorylation S1194 0.847 0.567 _FGS(ph)PKKDVDEYER_
SPEN Phosphorylation S1222 -0.507 -0.636 _SLVHEVGKPPQDVTDDS(ph)PPSK_
SPEN Phosphorylation S1268 0.027 0.553 _HGS(ph)FHEDEDPIGSPR_
SPEN Phosphorylation S1278 -0.017 -0.642 _HGSFHEDEDPIGS(ph)PR_
SPEN Phosphorylation S1287 0.636 0.812 _LLSVKGS(ph)PK_
SPEN Phosphorylation T1619 -0.114 -0.035 _EVEKQEDTENHPKT(ph)PESAPENK_
SPEN Ubiquitylation K1661 0.811 _TTGDK(gl)TVEAPLVTEEK_
SPEN Phosphorylation S1797 0.049 _AEAAPES(ph)QPPASEDLEVDPPVAAK_
SPEN Phosphorylation T1826 0.121 -0.031 _SKT(ph)PVQAAAVSIVEKPVTR_
SPEN Phosphorylation S1918 -0.859 -0.612 _SVYATMGDHENRS(ph)PVKEPVEQPR_
SPEN Phosphorylation S2101 0.491 0.415 _NVDAAVS(ph)PR_
SPEN Phosphorylation S2114 -0.434 _ES(ph)GVVAVSPEKSES(ph)PQKEDGLSSQLK_
SPEN Phosphorylation S2120 0.189 0.279 _ESGVVAVS(ph)PEKS(ph)ESPQKEDGLSSQLK_
SPEN Phosphorylation S2124 0.055 0.177 _ESGVVAVS(ph)PEKS(ph)ESPQKEDGLSSQLK_
SPEN Phosphorylation S2126 0.762 0.625 _SES(ph)PQKEDGLSSQLK_
SPEN Phosphorylation S2156 -0.898 _SDPVDPDKEPEKEDVSAS(ph)GPSPEATQLAK_
SPEN Phosphorylation S2159 -1.078 -0.906 _SDPVDPDKEPEKEDVSASGPS(ph)PEATQLAK_
SPEN Phosphorylation S2359 -0.781 _KVVAPVESHVPES(ph)NQAQGESPAANEGTTVQHPEAPQEEK_
SPEN Phosphorylation S2366 -1.191 _KVVAPVESHVPESNQAQGES(ph)PAANEGTTVQHPEAPQEEK_
SPEN Phosphorylation S2411 2.394 _IPSTENS(ph)SQEISVEER_
SPEN Phosphorylation S2412 -0.493 _IPSTENSS(ph)QEISVEER_
SPEN Phosphorylation T2421 -0.518 -1.005 _IPSTENSSQEISVEERT(ph)PTK_
SPEN Phosphorylation T2460 -1.260 _VHSIIESDPVT(ph)PPSDPSIPIPTLPSVTAAK_
SPEN Phosphorylation S2493 -0.826 -0.552 _LSPPVASGGIPHQS(ph)PPTK_
STRN3 Phosphorylation S229 -0.654 _NLEQILNGGES(ph)PK_
STRN3 Phosphorylation S335 2.687 _SSGDGTEWDKDDLS(ph)PTAEVWDVDQGLISK_
SUDS3 Phosphorylation S234 -2.333 -2.016 _RPAS(ph)PS(ph)SPEHLPATPAESPAQR_
SUDS3 Phosphorylation S236 -1.584 -1.386 _RPASPS(ph)SPEHLPATPAESPAQR_
SUMO1 Phosphorylation S2 0.441 0.416 _(ac)S(ph)DQEAKPSTEDLGDKK_
SUMO1 Ubiquitylation K7 -0.850 -1.885 _(ac)SDQEAK(gl)PSTEDLGDKK_
SUMO1 Ubiquitylation K16 -0.686 -1.532 _(ac)SDQEAKPSTEDLGDK(gl)KEGEYIK_
SUMO1 Ubiquitylation K17 -0.857 -1.847 _(ac)SDQEAKPSTEDLGDKK(gl)EGEYIK_
SUMO1 Ubiquitylation K23 0.713 -0.346 _EGEYIK(gl)LK_
SUMO1 Ubiquitylation K37 0.417 _VIGQDSSEIHFK(gl)VK_
SUMO1 Ubiquitylation K45 0.975 _MTTHLK(gl)K_
SUMO1 Ubiquitylation K46 0.647 _K(gl)LKESYCQR_
SUMO1 Ubiquitylation K48 -0.241 -0.185 _LK(gl)ESYCQR_
TAF7 Ubiquitylation K40 -0.984 0.784 _AVQSGHVNLK(gl)DR_
TAF7 Phosphorylation S171 1.574 _LLS(ph)TDAEAVSTR_
TAF7 Phosphorylation S201 0.225 0.409 _EAENQGLDISS(ph)PGMSGHR_
TBL1X Ubiquitylation K102 -0.183 _DK(gl)LAQQQAAAAAAAAAAASQQGSAK_
TBL1XR1 Ubiquitylation K102 -0.183 _DK(gl)LAQQQAAAAAAAAAAASQQGSAK_
TBL1Y Ubiquitylation K102 -0.183 _DK(gl)LAQQQAAAAAAAAAAASQQGSAK_
TBX22 Ubiquitylation K326 0.687 _NPFAK(gl)GFR_
TBX3 Ubiquitylation K466 -2.519 _EGTAPAK(gl)VEEAR_
TCF7L1 Ubiquitylation K88 -0.867 -0.222 _ESLEEAAK(gl)R_
TCF7L2 Ubiquitylation K88 -0.867 -0.222 _ESLEEAAK(gl)R_
TFAP4 Ubiquitylation K114 1.008 2.315 _LLQQNTQLK(gl)R_
TFAP4 Phosphorylation S123 0.832 _RFIQELSGS(ph)SPKR_
TFAP4 Phosphorylation S124 0.584 0.494 _RFIQELSGSS(ph)PK_
TGFB1 Ubiquitylation K50 -0.557 _GQILSK(gl)LR_
TIMELESS Ubiquitylation K528 -0.868 _GNLVVQNK(gl)QK_
TIMELESS Ubiquitylation K530 -0.868 _GNLVVQNK(gl)QK_
TIMELESS Phosphorylation S1087 0.076 -0.254 _LS(ph)PTQLR_
TIMELESS Phosphorylation S1149 1.556 1.776 _KAGLAS(ph)PEEEDAVGKEPLK_
TIMELESS Phosphorylation S1173 0.502 _RQLLDS(ph)DEEQEEDEGR_
TLE1 Phosphorylation S286 0.242 0.160 _DASSS(ph)PASTASSASSTSLK_
TLE2 Phosphorylation S213 0.308 0.467 _ESSANNSVS(ph)PSESLR_
TLE2 Phosphorylation S286 0.242 0.160 _DASSS(ph)PASTASSASSTSLK_
TLE2 Phosphorylation T295 -0.221 -0.058 _DAPT(ph)SPASVASSSSTPSSK_
TLE2 Phosphorylation S296 -0.181 -0.019 _DAPTS(ph)PASVASSSST(ph)PSSK_
TLE2 Phosphorylation S305 -0.995 _DAPTS(ph)PASVASSSS(ph)TPSSK_
TLE2 Phosphorylation T306 -0.680 -0.965 _DAPTS(ph)PASVASSSST(ph)PSSK_
TLE2 Phosphorylation T338 -1.514 -1.552 _NDAPT(ph)PGTSTT(ph)PGLR_
TLE2 Phosphorylation T341 -1.951 _NDAPT(ph)PGT(ph)STTPGLR_
TLE2 Phosphorylation T344 -1.034 -0.386 _NDAPTPGTSTT(ph)PGLR_
TLE4 Phosphorylation S206 0.530 _SSS(ph)VSPSASFR_
TLE4 Phosphorylation S208 0.427 0.632 _SSSVS(ph)PSASFR_
TLE4 Phosphorylation S286 0.242 0.160 _DASSS(ph)PASTASSASSTSLK_
TLE4 Phosphorylation S292 -0.214 -0.084 _DAPIS(ph)PASIASSSSTPSSK_
TP53 Ubiquitylation K120 -0.188 _LGFLHSGTAK(gl)SVTCTYSPALNK_
TP53 Ubiquitylation K164 0.157 -1.260 _AMAIYK(gl)QSQHMTEVVR_
TP53 Phosphorylation S314 -0.695 -1.000 _ALPNNTSS(ph)SPQPK_
TP53 Phosphorylation S315 -0.762 -0.959 _RALPNNTSSS(ph)PQPK_
TP53 Ubiquitylation K320 -0.978 _ALPNNTSSSPQPKK(gl)_
TP53 Ubiquitylation K357 -0.231 -0.823 _ELNEALELKDAQAGK(gl)EPGGSR_
TRIM11 Phosphorylation S85 -0.760 -1.064 _LHPPS(ph)PVPQGVCPAHR_
TRIM11 Ubiquitylation K141 -0.122 _LEK(gl)SLEHLRK_
TRIM11 Ubiquitylation K258 -1.789 -1.720 _VQDVK(gl)LQPPEVVPMELR_
TRIM24 Ubiquitylation K303 0.293 _IIEVNQNQK(gl)QVEQDIK_
TRIM24 Ubiquitylation K341 1.339 _MK(gl)LMQQQQEVAGLSK_
TRIM24 Phosphorylation S660 -0.300 _TVQS(ph)PNSSVPSPGLAGPVTMTSVHPPIR_
TRIM24 Phosphorylation S768 2.572 _SILTSLLLNSS(ph)QSSTSEETVLR_
TRIM24 Phosphorylation S771 3.067 _SILTSLLLNSSQSS(ph)TSEETVLR_
TRIM24 Phosphorylation S808 0.469 _SEWLDPS(ph)QKSPLHVGETR_
TRIM24 Phosphorylation S811 0.564 0.219 _SEWLDPSQKS(ph)PLHVGETR_
TRIM24 Phosphorylation S1042 2.366 1.350 _LKS(ph)IEER_
TRIM28 Phosphorylation S4 -0.337 _(ac)AAS(ph)AAAASAAAASAASGSPGPGEGSAGGEK_
TRIM28 Phosphorylation S14 -0.154 _(ac)AASAAAASAAAAS(ph)AASGSPGPGEGSAGGEK_
TRIM28 Phosphorylation S17 -0.227 -0.026 _(ac)AASAAAASAAAASAAS(ph)GSPGPGEGSAGGEK_
TRIM28 Phosphorylation S19 -0.068 -0.189 _(ac)AASAAAASAAAASAASGS(ph)PGPGEGSAGGEK_
TRIM28 Phosphorylation S26 0.197 _(ac)AASAAAASAAAASAASGSPGPGEGS(ph)AGGEK_
TRIM28 Phosphorylation S41 0.373 _RSTAPSAAAS(ph)ASASAAASSPAGGGAEALELLEHCGVCR_
TRIM28 Phosphorylation S43 0.010 _RSTAPSAAASAS(ph)ASAAASSPAGGGAEALELLEHCGVCR_
TRIM28 Phosphorylation S49 -0.388 -0.110 _STAPSAAASASASAAAS(ph)SPAGGGAEALELLEHCGVCR_
TRIM28 Phosphorylation S50 -0.113 0.075 _RSTAPSAAASASASAAASS(ph)PAGGGAEALELLEHCGVCR_
TRIM28 Ubiquitylation K254 0.323 0.381 _K(gl)LLASLVK_
TRIM28 Ubiquitylation K261 1.520 0.923 _LLASLVK(gl)R_
TRIM28 Ubiquitylation K266 0.465 -0.005 _LGDK(gl)HATLQK_
TRIM28 Ubiquitylation K272 1.576 -0.085 _LGDKHATLQK(gl)STK_
TRIM28 Ubiquitylation K319 0.332 0.451 _VLVNDAQK(gl)VTEGQQER_
TRIM28 Ubiquitylation K337 0.976 _QHWTM(ox)TK(gl)IQK_
TRIM28 Ubiquitylation K340 0.112 -0.105 _IQK(gl)HQEHILR_
TRIM28 Ubiquitylation K407 -2.105 _SAEAFGK(gl)IVAERPGTNSTGPAPMAPPR_
TRIM28 Phosphorylation S471 3.215 2.215 _S(ph)RSGEGEVSGLM(ox)R_
TRIM28 Phosphorylation S473 3.049 2.476 _S(ph)GEGEVSGLMR_
TRIM28 Phosphorylation S489 0.264 0.043 _VS(ph)LERLDLDLTADSQPPVFK_
TRIM28 Phosphorylation T498 0.265 _VSLERLDLDLT(ph)ADSQPPVFK_
TRIM28 Phosphorylation T541 3.001 1.292 _GAAAAATGQPGTAPAGT(ph)PGAPPLAGMAIVK_
TRIM28 Phosphorylation S594 1.033 _LAS(ph)PSGSTSSGLEVVAPEGTSAPGGGPGTLDDSATICR_
TRIM28 Phosphorylation S624 -1.117 _LASPSGSTSSGLEVVAPEGTSAPGGGPGTLDDS(ph)ATICR_
TRIM28 Phosphorylation S681 1.735 _EEDGS(ph)LSLDGADSTGVVAK_
TRIM28 Phosphorylation S752 0.314 0.567 _LQEKLS(ph)PPYSSPQEFAQDVGR_
TRIM28 Phosphorylation S756 -0.408 _LSPPYS(ph)SPQEFAQDVGR_
TRIM28 Ubiquitylation K770 0.289 _MFK(gl)QFNK_
TRIM28 Ubiquitylation K779 0.334 2.706 _LTEDK(gl)ADVQSIIGLQR_
TRIM33 Ubiquitylation K356 0.156 _IKEVNETNK(gl)R_
TRIM33 Ubiquitylation K769 0.051 _TSLSFK(gl)SDQVK_
TRPS1 Phosphorylation S178 0.790 _ATEETGQAQSGQANCQGLS(ph)PVSVASK_
TRPS1 Phosphorylation S216 0.413 -0.372 _TDLLVNDNPDPAPLS(ph)PELQDFK_
TRPS1 Phosphorylation T826 0.784 0.479 _T(ph)LRDSPNVEAAHLAR_
TRPS1 Phosphorylation S830 0.883 0.088 _TLRDS(ph)PNVEAAHLAR_
TRPS1 Phosphorylation S892 1.041 0.975 _RGS(ph)GVFCANCLTTK_
TSC22D4 Phosphorylation T229 0.430 1.033 _VEAEAGGSGART(ph)PPLSR_
TSG101 Ubiquitylation K237 -1.467 0.252 _ASLISAVSDK(gl)LR_
TSG101 Ubiquitylation K257 0.192 0.329 _AQAELNALK(gl)R_
TSHZ3 Phosphorylation S333 0.171 _KASLELELPSS(ph)PDSTGGTPK_
TSHZ3 Phosphorylation S461 -0.148 _VQSVPLAATTFTSPSNTPAS(ph)ISPK_
TSHZ3 Phosphorylation S463 -0.740 -0.907 _VQSVPLAATTFTSPSNTPASIS(ph)PK_
TWIST2 Ubiquitylation K150 -0.176 _IQTLK(gl)LAAR_
UBA3 Ubiquitylation K307 0.013 0.773 _LTQGVVK(gl)R_
UBA3 Ubiquitylation K409 0.234 _SPAITATLEGK(gl)NR_
UBE2I Ubiquitylation K49 0.535 _K(gl)GTPWEGGLFK_
UBE2I Ubiquitylation K59 0.481 _GTPWEGGLFK(gl)LR_
UIMC1 Ubiquitylation K19 -0.178 -1.011 _NLEK(gl)KDVETTSSVSVK_
UIMC1 Ubiquitylation K20 -0.247 -0.187 _K(gl)DVETTSSVSVK_
UIMC1 Ubiquitylation K31 0.443 0.015 _KDVETTSSVSVK(gl)R_
UIMC1 Phosphorylation S101 2.729 2.276 _EVNS(ph)QEEEEEELLRK_
UIMC1 Phosphorylation S140 2.351 _SRPLATGPSS(ph)QSHQEK_
UIMC1 Ubiquitylation K245 0.435 0.000 _GSAFLK(gl)AVQGSGDTSR_
UIMC1 Ubiquitylation K374 -0.119 -1.262 _TK(gl)DFQESSIK_
UIMC1 Ubiquitylation K382 0.111 -0.591 _TKDFQESSIK(gl)SLK_
UIMC1 Ubiquitylation K545 -0.089 -0.679 _TK(gl)SDSGTAAQTSLDIDKNEK_
UIMC1 Ubiquitylation K568 -1.100 -0.475 _CYLCK(gl)SLVPFR_
UIMC1 Ubiquitylation K608 0.301 -0.587 _ACSTVEGK(gl)WQQR_
UIMC1 Phosphorylation S654 0.098 0.120 _VPS(ph)PGM(ox)EEAGCSR_
UIMC1 Phosphorylation S678 0.108 -0.289 _RDLNES(ph)PVK_
USP47 Phosphorylation S832 0.001 -0.284 _LFVLLPEQS(ph)PVSYSK_
USP47 Phosphorylation S910 1.689 2.323 _STETSDFENIES(ph)PLNER_
USP47 Phosphorylation T932 0.805 _ELEQHIQT(ph)SDPENFQSEER_
USP47 Phosphorylation S933 0.302 0.148 _ELEQHIQTS(ph)DPENFQSEER_
WNT5A Ubiquitylation K268 -0.304 _VGDALK(gl)EK_
WWP1 Ubiquitylation K66 -0.890 _WK(gl)QPLTVIVTPVSK_
WWP1 Ubiquitylation K328 -0.364 0.487 _SSSAFEAAK(gl)SR_
WWP1 Ubiquitylation K350 0.049 0.396 _VYYVDHVEK(gl)R_
WWP1 Ubiquitylation K446 -1.514 -1.539 _EFDPLGPLPPGWEK(gl)R_
WWP1 Ubiquitylation K478 -1.265 _SQGQLNEK(gl)PLPEGWEMR_
WWP1 Ubiquitylation K513 -0.564 1.593 _TGK(gl)SALDNGPQIAYVR_
WWP1 Ubiquitylation K536 -1.895 1.126 _SSVTK(gl)GGPQIAYER_
WWP1 Ubiquitylation K861 -0.810 0.596 _VGK(gl)ENWLPR_
XRCC5 Ubiquitylation K195 -0.495 -0.075 _LGGHGPSFPLK(gl)GITEQQK_
XRCC5 Ubiquitylation K265 -0.577 0.489 _IAAYK(gl)SILQER_
XRCC5 Ubiquitylation K282 0.763 _TWTVVDAK(gl)TLKK_
XRCC5 Ubiquitylation K325 0.022 -0.122 _YGSDIVPFSK(gl)VDEEQMK_
XRCC5 Ubiquitylation K332 -0.032 0.491 _VDEEQMK(gl)YK_
XRCC5 Ubiquitylation K347 0.588 1.044 _CFSVLGFCK(gl)SSQVQR_
XRCC5 Ubiquitylation K481 -1.648 0.087 _TDTLEDLFPTTK(gl)IPNPR_
XRCC5 Ubiquitylation K532 0.343 -0.001 _SQIPLSK(gl)IK_
XRCC5 Ubiquitylation K534 -0.146 0.207 _SQIPLSKIK(gl)_
XRCC5 Ubiquitylation K543 0.666 0.157 _TLFPLIEAK(gl)KK_
XRCC5 Ubiquitylation K544 0.165 0.157 _TLFPLIEAKK(gl)_
XRCC5 Ubiquitylation K660 0.644 1.285 _FNNFLK(gl)ALQEK_
XRCC5 Ubiquitylation K665 0.630 0.990 _ALQEK(gl)VEIK_
XRCC5 Ubiquitylation K702 0.626 0.332 _EEASGSSVTAEEAK(gl)K_
XRCC5 Ubiquitylation K703 0.743 0.332 _EEASGSSVTAEEAKK(gl)_
XRCC6 Phosphorylation S27 0.932 0.873 _TEGDEEAEEEQEENLEAS(ph)GDYK_
XRCC6 Ubiquitylation K114 -0.534 -0.728 _NIYVLQELDNPGAK(gl)R_
XRCC6 Ubiquitylation K123 -0.756 _ILELDQFK(gl)GQQGQK_
XRCC6 Ubiquitylation K129 0.079 -0.683 _ILELDQFKGQQGQK(gl)R_
XRCC6 Ubiquitylation K182 -1.603 _IMLFTNEDNPHGNDSAK(gl)ASR_
XRCC6 Ubiquitylation K282 -2.587 _ALK(gl)PPPIK_
XRCC6 Ubiquitylation K287 -1.436 -2.286 _ALKPPPIK(gl)LYR_
XRCC6 Ubiquitylation K299 -0.535 -0.792 _ETNEPVKTK(gl)TR_
XRCC6 Ubiquitylation K317 -0.584 -0.964 _TFNTSTGGLLLPSDTK(gl)R_
XRCC6 Ubiquitylation K331 -1.666 _QIILEK(gl)EETEELKR_
XRCC6 Ubiquitylation K338 -1.479 -1.003 _QIILEKEETEELK(gl)R_
XRCC6 Ubiquitylation K451 -1.713 -1.901 _MPFTEK(gl)IMATPEQVGK_
XRCC6 Phosphorylation T455 -0.085 0.348 _IMAT(ph)PEQVGK_
XRCC6 Ubiquitylation K461 0.239 -0.409 _IMATPEQVGK(gl)MK_
XRCC6 Ubiquitylation K463 -0.609 -0.641 _MK(gl)AIVEK_
XRCC6 Ubiquitylation K468 -1.302 -0.451 _AIVEK(gl)LR_
XRCC6 Phosphorylation S475 1.136 0.167 _S(ph)DSFENPVLQQHFR_
XRCC6 Phosphorylation S477 1.023 0.034 _SDS(ph)FENPVLQQHFR_
XRCC6 Ubiquitylation K516 -1.089 _VEAMNK(gl)R_
XRCC6 Phosphorylation S560 0.318 0.378 _VEYS(ph)EEELKTHISK_
XRCC6 Ubiquitylation K565 0.021 -0.887 _VEYSEEELK(gl)THISK_
XRCC6 Ubiquitylation K575 0.031 -0.121 _GTLGK(gl)FTVPMLK_
XRCC6 Ubiquitylation K591 0.474 0.187 _AYGLK(gl)SGLK_
YBX1 Ubiquitylation K64 5.830 4.056 _VLGTVK(gl)WFNVR_
YBX1 Ubiquitylation K137 -0.751 0.084 _GAEAANVTGPGGVPVQGSK(gl)YAADR_
YBX1 Phosphorylation Y162 -0.210 _NYQQNY(ph)QNSESGEKNEGSESAPEGQAQQR_
YBX1 Phosphorylation S165 0.119 0.151 _NYQQNYQNS(ph)ESGEK_
YBX1 Ubiquitylation K170 -0.297 0.298 _NYQQNYQNSESGEK(gl)NEGSESAPEGQAQQR_
YBX1 Phosphorylation S174 0.041 0.228 _NEGS(ph)ESAPEGQAQQR_
YBX1 Phosphorylation S176 0.061 0.075 _NEGSES(ph)APEGQAQQR_
YBX1 Phosphorylation S209 0.658 -0.148 _RPQYS(ph)NPPVQGEVM(ox)EGADNQGAGEQGRPVR_
YEATS2 Phosphorylation S118 0.334 0.543 _KFLES(ph)PSR_
YEATS2 Phosphorylation S120 0.182 _KFLESPS(ph)R_
YEATS2 Phosphorylation S366 -0.136 _AS(ph)SPIKQSHEPVPDTSVEK_
YEATS2 Phosphorylation S367 -0.293 -0.048 _ASS(ph)PIKQSHEPVPDTSVEK_
YEATS2 Phosphorylation T407 -1.280 _HTPFYALPSSLERT(ph)PTK_
YEATS2 Phosphorylation S447 -1.015 -1.547 _IVPQSQVPNPES(ph)PGK_
YEATS2 Phosphorylation S463 -1.995 -1.828 _IVS(ph)GSPISTPSPS(ph)PLPR_
YEATS2 Phosphorylation S465 -1.476 -1.828 _IVSGS(ph)PISTPSPS(ph)PLPR_
YEATS2 Phosphorylation S473 -1.617 -1.828 _IVSGS(ph)PISTPSPS(ph)PLPR_
YEATS2 Phosphorylation S536 -0.308 -1.315 _ISTASQVSQGTGS(ph)PVPK_
YEATS2 Phosphorylation S627 -0.220 -0.802 _GGHM(ox)IAVS(ph)PQK_
YJEFN3 Ubiquitylation K22 -2.069 _VKQDMPPPGGYGPIDYK(gl)R_
YJEFN3 Ubiquitylation K105 -1.894 _DVPDWK(gl)VGESVFHTTR_
YWHAB Ubiquitylation K11 1.057 1.322 _(ac)TMDKSELVQK(gl)AK_
YWHAB Ubiquitylation K13 0.060 0.388 _AK(gl)LAEQAER_
YWHAB Ubiquitylation K70 0.558 -0.175 _VISSIEQK(gl)TER_
YWHAB Ubiquitylation K140 0.531 _YLSEVASGDNK(gl)QTTVSNSQQAYQEAFEISKK_
YWHAB Ubiquitylation K159 0.300 _QTTVSNSQQAYQEAFEISK(gl)K_
YWHAB Ubiquitylation K160 -0.439 -0.371 _K(gl)EMQPTHPIR_
YWHAQ Ubiquitylation K3 0.827 _(ac)MEK(gl)TELIQK_
YWHAQ Ubiquitylation K9 0.588 0.253 _(ac)MEKTELIQK(gl)AK_
YWHAQ Ubiquitylation K11 0.561 0.388 _AK(gl)LAEQAER_
YWHAQ Ubiquitylation K27 -0.849 _YDDMATCMK(gl)AVTEQGAELSNEER_
YWHAQ Ubiquitylation K49 0.260 0.469 _NLLSVAYK(gl)NVVGGR_
YWHAQ Ubiquitylation K68 0.288 _VISSIEQK(gl)TDTSDKK_
YWHAQ Ubiquitylation K74 0.305 _TDTSDK(gl)KLQLIK_
YWHAQ Ubiquitylation K75 0.253 _TDTSDKK(gl)LQLIK_
YWHAQ Ubiquitylation K80 0.655 1.500 _LQLIK(gl)DYR_
YWHAQ Ubiquitylation K85 0.110 _EK(gl)VESELR_
YWHAQ Ubiquitylation K120 0.512 0.946 _VFYLK(gl)MK_
YWHAQ Ubiquitylation K122 0.426 0.859 _MK(gl)GDYFR_
YWHAQ Ubiquitylation K158 -0.439 -0.371 _K(gl)EMQPTHPIR_
ZBTB21 Phosphorylation S343 -0.121 -0.093 _S(ph)LSMDSQVPVYSPSIDLK_
ZBTB21 Phosphorylation S345 -0.222 -0.393 _SLS(ph)MDSQVPVYSPSIDLK_
ZBTB21 Phosphorylation T431 -0.116 _IKT(ph)EPSSPLSDPSDIIR_
ZBTB21 Phosphorylation S434 -0.439 -0.578 _IKTEPS(ph)SPLSDPSDIIR_
ZBTB21 Phosphorylation S435 -0.198 -0.291 _TEPSS(ph)PLSDPSDIIR_
ZBTB21 Phosphorylation S714 0.633 0.737 _EHAPLAS(ph)PVENKEVYQCR_
ZBTB21 Phosphorylation S1003 -0.926 -1.132 _IQPLEPDS(ph)PTGLSENPTPATEK_
ZBTB7A Phosphorylation S337 0.834 0.709 _AGAAAGDS(ph)DEESRADDKGVMDYYLK_
ZBTB7A Phosphorylation S341 0.848 _AGAAAGDSDEES(ph)RADDKGVMDYYLK_
ZBTB7A Phosphorylation S525 -1.261 -1.357 _VRGGAPDPSPGATATPGAPAQPS(ph)SPDAR_
ZBTB7A Phosphorylation S526 -2.180 -2.295 _GGAPDPSPGATATPGAPAQPSS(ph)PDAR_
ZBTB7A Phosphorylation S549 0.508 0.227 _HFKDEDEDEDVAS(ph)PDGLGR_
ZEB1 Ubiquitylation K77 0.237 _FTSLK(gl)EHIK_
ZEB1 Ubiquitylation K398 -0.697 0.131 _SEK(gl)LPEDLTVK_
ZEB1 Phosphorylation S713 -0.669 -0.753 _NNDQPQSANANEPQDSTVNLQS(ph)PLK_
ZEB1 Phosphorylation S1025 0.260 _REAEERDS(ph)TEQEEAGPEILSNEHVGAR_
ZEB1 Phosphorylation T1026 0.260 _REAEERDS(ph)TEQEEAGPEILSNEHVGAR_
ZFHX3 Phosphorylation S425 -0.531 -0.563 _TPITSVPLGPLAS(ph)SPTK_
ZHX1 Phosphorylation S648 0.113 0.003 _EEAGETS(ph)PADESGAPK_
ZHX3 Phosphorylation S946 -0.507 -0.518 _VPEASSEPFDTSS(ph)PQAGR_
ZIC2 Ubiquitylation K253 -0.697 0.374 _QQCIK(gl)QELICK_
ZKSCAN3 Phosphorylation S42 0.848 _VEEEEAGFPSSPDLGS(ph)EGSR_
ZNF148 Phosphorylation T305 -0.023 _GGLLTSEEDSGFST(ph)SPKDNSLPK_
ZNF148 Phosphorylation S306 2.082 _GGLLTSEEDSGFSTS(ph)PK_
ZNF148 Phosphorylation S311 0.900 _GGLLTSEEDSGFSTSPKDNS(ph)LPK_
ZNF148 Phosphorylation S665 2.220 _SGMNS(ph)PLR_
ZNF217 Phosphorylation S407 -0.169 0.426 _AGAES(ph)PTMSVDGR_
ZNF219 Phosphorylation S16 -0.689 -0.956 _APSGHLAPS(ph)PPAFDGELDLQR_
ZNF219 Phosphorylation T257 -0.413 _SVPQPEPEPEPEREAT(ph)PTPAPAAPEEPPAPPEFR_
ZNF219 Phosphorylation T259 -0.413 _SVPQPEPEPEPEREAT(ph)PTPAPAAPEEPPAPPEFR_
ZNF24 Phosphorylation T16 4.665 4.532 _(ac)SAQSVEEDSILIIPT(ph)PDEEEK_
ZNF24 Phosphorylation T330 0.316 _IHT(ph)GEKPYECVQCGK_
ZNF281 Ubiquitylation K622 -1.827 _SESQK(gl)EDPFNIAEPR_
ZNF281 Phosphorylation S651 0.362 0.137 _VDLHTSGEHSELVQEENLS(ph)PGTQTPSNDK_
ZNF281 Phosphorylation T654 0.273 _VDLHTSGEHSELVQEENLSPGT(ph)QTPSNDK_
ZNF281 Phosphorylation T888 0.078 -0.076 _VKT(ph)PTSQSYR_
ZNF282 Ubiquitylation K111 -0.499 _K(gl)VDAQASQLLNLEGR_
ZNF282 Phosphorylation S319 -0.495 _AIPTESITDS(ph)PISAQDLLSR_
ZNF639 Phosphorylation S88 1.106 0.234 _NQNYLVPS(ph)PVLR_
ZNF639 Ubiquitylation K369 0.828 _ITFDK(gl)CK_
ZNF703 Phosphorylation S2 -0.222 _(ac)S(ph)DSPAGS(ph)NPRTPESSGSGSGGGGK_
ZNF703 Phosphorylation S8 -0.222 _(ac)S(ph)DSPAGS(ph)NPRTPESSGSGSGGGGK_
ZNF703 Phosphorylation T12 -0.699 0.126 _(ac)SDSPAGSNPRT(ph)PESSGSGSGGGGK_
ZNF703 Phosphorylation S252 -0.792 -0.340 _DQEPKPS(ph)PEPAAVSR_


© Copyright Svejstrup Laboratory 2015