bioLOGIC Data » bioLOGIC CategoryView » bioLOGIC VennView » Experimental Details »

bioLOGIC Data

bioLOGIC Data


Exact search


Query: ILF3

RNAi screen result RNAPII IP (PI) CSB IP CSB IP (PI) Chrom. Chrom. (PI) Phosphorylation Ubiquitylation
W
[Click on the plots to view the data selection in the respective scatterplot]

Protein Results:

 Results for post-translational modifications: see below | Red/green: hit at lower/upper end of the respective screen
Gene name Point score Z-score sums RNAi high RNAi low RNAPII-IP (PI) CSB-IP CSB-IP (PI) Chrom. Chrom. (PI)
ILF3 1 1.173 -2.400 4.920
ILF3 1 1.173 -2.400 4.920 -3.271 -0.998 -0.391 -0.709 -0.019
ILF3 1 1.173 -2.400 4.920 -0.465 -5.193 -2.940 -2.419

PTM Sites:

 Back to Protein Results | Red/green: hit at lower/upper end of the respective screen
Gene name PTM type PTM site UV UV (PI) Sequence
ILF3 Ubiquitylation K100 0.868 0.952 _VGLVAK(gl)GLLLK_
ILF3 Ubiquitylation K202 0.668 0.564 _QK(gl)CLAALASLR_
ILF3 Phosphorylation S812 0.288 0.380 _FNYSGS(ph)GGR_
ILF3 Phosphorylation S382 0.107 0.115 _RPM(ox)EEDGEEKS(ph)PSK_
ILF3 Phosphorylation T592 -0.375 -0.375 _LFPDT(ph)PLALDANK_
ILF3 Phosphorylation S62 -0.267 -0.683 _GSSEQAES(ph)DNMDVPPEDDSK_
ILF3 Phosphorylation S482 -1.214 -1.233 _GEDS(ph)AEETEAKPAVVAPAPVVEAVSTPSAAFPSDATAENVK_
ILF3 Phosphorylation T486 -1.655 -1.310 _GEDS(ph)AEETEAKPAVVAPAPVVEAVSTPSAAFPSDATAEQGPILTK_
ILF3 Phosphorylation S482 -1.655 -1.471 _GEDS(ph)AEETEAKPAVVAPAPVVEAVSTPSAAFPSDATAEQGPILTK_
ILF3 Phosphorylation T486 -1.747 -6.485 _DSSKGEDSAEET(ph)EAKPAVVAPAPVVEAVSTPSAAFPSDATAENVK_
ILF3 Ubiquitylation K119 0.194 _EK(gl)PTTALLDK_
ILF3 Ubiquitylation K454 1.019 _TAK(gl)LHVAVK_
ILF3 Ubiquitylation K604 -0.285 _LFPDTPLALDANK(gl)K_
ILF3 Ubiquitylation K605 -0.285 _LFPDTPLALDANK(gl)K_
ILF3 Phosphorylation S384 0.054 _RPM(ox)EEDGEEKS(ph)PSK_

Background Information for ILF3:


Pubmed-ILF3 »
Uniprot-ILF3 »
Biogrid-ILF3 »
ProteomicsDB-ILF3 »

Tumorportal-ILF3 »
COSMIC-ILF3 »
GenomeRNAi-ILF3 »
Genecards-ILF3


Protein-protein Interactions for ILF3
Show screen data for Category Name and Description Link to cat description Data Source
Category members IP bait CCDC9 Cat. description Hein, Mann, Cell 2015
Category members IP bait EIF3E Cat. description Hein, Mann, Cell 2015
Category members IP bait FUS Cat. description Hein, Mann, Cell 2015
Category members IP bait HNRNPA1 Cat. description Hein, Mann, Cell 2015
Category members IP bait HNRNPU Cat. description Hein, Mann, Cell 2015
Category members IP bait MATR3 Cat. description Hein, Mann, Cell 2015
Category members IP bait MPHOSPH8 Cat. description Hein, Mann, Cell 2015
Category members IP bait PPP1CB Cat. description Hein, Mann, Cell 2015
Category members IP bait PPP1CC Cat. description Hein, Mann, Cell 2015
Category members IP bait PRMT6 Cat. description Hein, Mann, Cell 2015
Category members IP bait RPL35 Cat. description Hein, Mann, Cell 2015
Category members IP bait RRBP1 Cat. description Hein, Mann, Cell 2015
Category members IP bait SNCA Cat. description Hein, Mann, Cell 2015
Category members IP bait TAF15 Cat. description Hein, Mann, Cell 2015
Category members IP bait ILF2 Cat. description BioPlex, Huttlin, Gygi, Cell 2015


Protein Domains in ILF3
Domain name Domain Description TC-NER relevance -log10(p-value)
Category members dsRNA-bd_dom IPR014720 0.23
Category members DZF_dom IPR006561 0


Protein complexes (CORUM database) featuring ILF3
Category Type Category ID Category Name Data Source TC-NER relevance -log10(p-value)
Category members Corum 3055 Nop56p-associated pre-rRNA complex Database INF
Category members Corum 5615 Emerin complex 52 Database 0.99
Category members Corum 5183 DNA-PK-Ku-eIF2-NF90-NF45 complex Database 0.83
Category members Corum 1332 Large Drosha complex Database 0.08
Category members Corum 3082 DGCR8 multiprotein complex Database 0.07
Category members Corum 3080 ILF3-XPO5 complex Database 0.04
Category members Corum 3079 DGCR8-ILF3 complex Database 0


Categories featuring ILF3
Category Type Category ID Category Name Data Source TC-NER relevance -log10(p-value)
Category members DDR Literature pubmedid:24332808 Marechal et al., 2014 RPA-mediated recruitment INF
Category members GO Category GO:0003723 RNA binding Database INF
Category members GO Category GO:0005515 protein binding Database INF
Category members GO Category GO:0005634 nucleus Database INF
Category members GO Category GO:0005730 nucleolus Database 13.38
Category members GO Category GO:0005737 cytoplasm Database 12.81
Category members GO Category GO:0030529 ribonucleoprotein complex Database 8.45
Category members GO Category GO:0005739 mitochondrion Database 1.67
Category members GO Category GO:0003677 DNA binding Database 1.53
Category members GO Category GO:0045892 negative regulation of transcription, DNA-dependent Database 1.15
Category members GO Category GO:0006351 transcription, DNA-templated Database 1.07
Category members GO Category GO:0017148 negative regulation of translation Database 0.34
Category members GO Category GO:0045893 positive regulation of transcription, DNA-dependent Database 0.28
Category members GO Category GO:0003725 double-stranded RNA binding Database 0.1
Category members GO Category GO:0051607 defense response to virus Database 0.07
Category members GO Category GO:0006468 protein phosphorylation Database 0.04
Category members GO Category GO:0045071 negative regulation of viral genome replication Database 0


.

© Copyright Svejstrup Laboratory 2015