bioLOGIC Data » bioLOGIC CategoryView » bioLOGIC VennView » Experimental Details »

bioLOGIC Data

bioLOGIC Data


Exact search


Query: LDB1

RNAi screen result RNAPII IP (PI) CSB IP CSB IP (PI) Chrom. Chrom. (PI) Phosphorylation Ubiquitylation
W
[Click on the plots to view the data selection in the respective scatterplot]

Protein Results:

 Results for post-translational modifications: see below | Red/green: hit at lower/upper end of the respective screen
Gene name Point score Z-score sums RNAi high RNAi low RNAPII-IP (PI) CSB-IP CSB-IP (PI) Chrom. Chrom. (PI)
LDB1 0 -3.264 0.670 -0.650 -1.168

PTM Sites:

 Back to Protein Results | Red/green: hit at lower/upper end of the respective screen
Gene name PTM type PTM site UV UV (PI) Sequence
LDB1 Phosphorylation S323 -0.402 -0.031 _KS(ph)PASTFALSSQVPDVMVVGEPTLMGGEFGDEDER_
LDB1 Ubiquitylation K76 -0.052 _IFELNK(gl)R_
LDB1 Ubiquitylation K271 -0.154 _DCLK(gl)TCLFQK_
LDB1 Ubiquitylation K277 -1.611 -0.630 _TCLFQK(gl)WQR_

Background Information for LDB1:


Pubmed-LDB1 »
Uniprot-LDB1 »
Biogrid-LDB1 »
ProteomicsDB-LDB1 »

Tumorportal-LDB1 »
COSMIC-LDB1 »
GenomeRNAi-LDB1 »
Genecards-LDB1


Protein-protein Interactions for LDB1
Show screen data for Category Name and Description Link to cat description Data Source
Category members IP bait CETN1 Cat. description BioPlex, Huttlin, Gygi, Cell 2015
Category members IP bait IDI2 Cat. description BioPlex, Huttlin, Gygi, Cell 2015
Category members IP bait LHX4 Cat. description BioPlex, Huttlin, Gygi, Cell 2015
Category members IP bait LHX6 Cat. description BioPlex, Huttlin, Gygi, Cell 2015
Category members IP bait LHX9 Cat. description BioPlex, Huttlin, Gygi, Cell 2015
Category members IP bait LMO2 Cat. description BioPlex, Huttlin, Gygi, Cell 2015
Category members IP bait LMX1B Cat. description BioPlex, Huttlin, Gygi, Cell 2015
Category members IP bait PICK1 Cat. description BioPlex, Huttlin, Gygi, Cell 2015
Category members IP bait SSBP2 Cat. description BioPlex, Huttlin, Gygi, Cell 2015
Category members IP bait SSBP3 Cat. description BioPlex, Huttlin, Gygi, Cell 2015
Category members IP bait SSBP4 Cat. description BioPlex, Huttlin, Gygi, Cell 2015


Protein Domains in LDB1
Domain name Domain Description TC-NER relevance -log10(p-value)
Category members LIM-bd/SEUSS IPR029005 0.32


Protein complexes (CORUM database) featuring LDB1
Category Type Category ID Category Name Data Source TC-NER relevance -log10(p-value)
Category members Corum 1372 Rb-tal-1-E2A-Lmo2-Ldb1 complex Database 0.05
Category members Corum 140 E-box sequence-binding complex Database 0
Category members Corum 2214 LMO4-BRCA1-CTIP-LDB1 complex Database 0


Categories featuring LDB1
Category Type Category ID Category Name Data Source TC-NER relevance -log10(p-value)
Category members GO Category GO:0005515 protein binding Database INF
Category members GO Category GO:0005634 nucleus Database INF
Category members GO Category GO:0003682 chromatin binding Database 6.07
Category members GO Category GO:0043234 protein complex Database 2.73
Category members GO Category GO:0019899 enzyme binding Database 1.57
Category members GO Category GO:0003677 DNA binding Database 1.53
Category members GO Category GO:0005911 cell-cell junction Database 1.4
Category members GO Category GO:0045892 negative regulation of transcription, DNA-dependent Database 1.15
Category members GO Category GO:0006351 transcription, DNA-templated Database 1.07
Category members GO Category GO:0006366 transcription from RNA polymerase II promoter Database 0.96
Category members GO Category GO:0000790 nuclear chromatin Database 0.46
Category members GO Category GO:0045647 negative regulation of erythrocyte differentiation Database 0.41
Category members GO Category GO:0010669 epithelial structure maintenance Database 0.36
Category members GO Category GO:0032784 regulation of DNA-dependent transcription, elongation Database 0.33
Category members GO Category GO:0001102 RNA polymerase II activating transcription factor binding Database 0.31
Category members GO Category GO:0007275 multicellular organismal development Database 0.31
Category members Pathway Pathway_1176 BIOCARTA_PITX2_PATHWAY 0 0.29
Category members GO Category GO:0060322 head development Database 0.27
Category members GO Category GO:0005667 transcription factor complex Database 0.19
Category members GO Category GO:0021549 cerebellum development Database 0.14
Category members GO Category GO:0045944 positive regulation of transcription from RNA polymerase II promoter Database 0.13
Category members GO Category GO:0016055 Wnt signaling pathway Database 0.11
Category members GO Category GO:0043621 protein self-association Database 0.07
Category members GO Category GO:0045785 positive regulation of cell adhesion Database 0.04
Category members GO Category GO:0000989 transcription factor binding transcription factor activity Database 0.01
Category members GO Category GO:0001158 enhancer sequence-specific DNA binding Database 0
Category members GO Category GO:0001702 gastrulation with mouth forming second Database 0
Category members GO Category GO:0001942 hair follicle development Database 0
Category members GO Category GO:0003714 transcription corepressor activity Database 0
Category members GO Category GO:0006355 regulation of transcription, DNA-dependent Database 0
Category members GO Category GO:0009948 anterior/posterior axis specification Database 0
Category members GO Category GO:0021702 cerebellar Purkinje cell differentiation Database 0
Category members GO Category GO:0030182 neuron differentiation Database 0
Category members GO Category GO:0030274 LIM domain binding Database 0
Category members GO Category GO:0035019 somatic stem cell maintenance Database 0
Category members GO Category GO:0042803 protein homodimerization activity Database 0
Category members GO Category GO:0046985 positive regulation of hemoglobin biosynthetic process Database 0


.

© Copyright Svejstrup Laboratory 2015