bioLOGIC Data » bioLOGIC CategoryView » bioLOGIC VennView » Experimental Details »
bioLOGIC Category

Results for the Category
positive regulation of cell adhesion
(GO:0045785)

RNAi screen result RNAPII IP (MG132) CSB IP CSB IP (MG132) Chrom. Chrom. (MG132) Ubi /Phospo Ubi /Phospho (MG132)
W

Protein Results:

Results for post-translational modifications (below)
Gene name MGoogle Score RNAi high RNAi low RNAPII-IP (MG132) CSB-IP CSB-IP (MG132) Chrom. Chrom. (MG132)
RHOA 0 -0.510 1.370 -0.485 0.532 0.279
PRKD2 0 0.050 0.170 0.914
PRKD2 0 0.050 0.170
C1QBP 0 1.100 -0.820 0.115 -0.813 0.337 0.378
C1QBP 0 1.100 -0.820 -0.487
ITGAV 0 -0.297 -0.090 0.262
TPM1 0 0.280 -0.190
ERBB2 0 -1.310 1.360
DAB2 0 0.510 -0.470
PRKCA 0 0.750 -0.690 0.349 0.585
PRKCA 0 0.750 -0.690
FLCN 0 1.070 -0.810
ITGA2 0 -0.370 0.660 0.847 0.435
LDB1 0 0.670 -0.650 -1.168

PTM Sites:

Back to Protein Results
Gene name PTM type PTM site UV UV (MG132) Sequence
DAB2 Phosphorylation S401 -0.704 -0.722 _SSPNPFVGS(ph)PPK_
ERBB2 Ubiquitylation K200 -2.073 _ACHPCSPMCK(gl)GSR_
ERBB2 Ubiquitylation K369 -0.742 _AVTSANIQEFAGCKK(gl)_
ERBB2 Ubiquitylation K747 -0.505 -0.019 _GIWIPDGENVK(gl)IPVAIK_
ERBB2 Ubiquitylation K854 -0.859 _NVLVK(gl)SPNHVK_
ERBB2 Phosphorylation S1054 -0.476 -0.706 _S(ph)GGGDLTLGLEPSEEEAPR_
FLCN Phosphorylation S62 -0.873 -0.905 _AHS(ph)PAEGASVESSSPGPK_
ITGAV Ubiquitylation K233 0.373 _YDPNVYSIK(gl)YNNQLATR_
ITGAV Ubiquitylation K360 0.294 _ASGDFQTTK(gl)LNGFEVFAR_
ITGAV Ubiquitylation K923 0.636 _GK(gl)SAILYVK_
LDB1 Ubiquitylation K76 -0.052 _IFELNK(gl)R_
LDB1 Ubiquitylation K271 -0.154 _DCLK(gl)TCLFQK_
LDB1 Ubiquitylation K277 -1.611 -0.630 _TCLFQK(gl)WQR_
LDB1 Phosphorylation S323 -0.402 -0.031 _KS(ph)PASTFALSSQVPDVMVVGEPTLMGGEFGDEDER_
PRKCA Phosphorylation S10 -0.650 0.036 _(ac)ADVFPGNDS(ph)TASQDVANR_
PRKCA Phosphorylation S13 -1.038 0.335 _(ac)ADVFPGNDSTAS(ph)QDVANR_
PRKCA Phosphorylation S226 0.693 0.415 _STLNPQWNES(ph)FTFK_
PRKCA Ubiquitylation K316 -0.522 -0.535 _LGPAGNK(gl)VISPSEDR_
PRKD2 Phosphorylation S197 0.239 0.895 _RLS(ph)STSLASGHSVR_
PRKD2 Phosphorylation T211 -0.119 _LGT(ph)SESLPCTAEELSR_
PRKD2 Phosphorylation S212 0.113 _LGTS(ph)ESLPCTAEELSR_
PRKD2 Phosphorylation S214 0.216 0.302 _LGTSES(ph)LPCTAEELSR_
PRKD2 Phosphorylation S710 -0.413 -0.511 _S(ph)VVGTPAYLAPEVLLNQGYNR_
PRKD2 Phosphorylation T714 -0.279 _S(ph)VVGTPAYLAPEVLLNQGYNR_
PRKD2 Ubiquitylation K730 1.177 _IIGEK(gl)SFR_
PRKD2 Phosphorylation S886 -0.718 -0.305 _DLGGACPPQDHDMQGLAERIS(ph)VL_
RHOA Ubiquitylation K6 0.708 _K(gl)KLVIVGDGACGK_
RHOA Ubiquitylation K7 0.708 _K(gl)KLVIVGDGACGK_
RHOA Ubiquitylation K118 -0.408 _HFCPNVPIILVGNK(gl)K_
RHOA Ubiquitylation K119 -0.408 _HFCPNVPIILVGNK(gl)K_
RHOA Ubiquitylation K135 -0.528 -0.796 _MK(gl)QEPVKPEEGRDMANR_
RHOA Ubiquitylation K162 0.345 0.453 _IGAFGYMECSAK(gl)TK_
TPM1 Ubiquitylation K30 -1.537 _AEQAEADKK(gl)AAEDR_


© Copyright Svejstrup Laboratory 2015