bioLOGIC Data » bioLOGIC CategoryView » bioLOGIC VennView » Experimental Details »
bioLOGIC Category

Results for the Category
anterior/posterior axis specification
(GO:0009948)

RNAi screen result RNAPII IP (MG132) CSB IP CSB IP (MG132) Chrom. Chrom. (MG132) Ubi /Phospo Ubi /Phospho (MG132)
W

Protein Results:

Results for post-translational modifications (below)
Gene name MGoogle Score RNAi high RNAi low RNAPII-IP (MG132) CSB-IP CSB-IP (MG132) Chrom. Chrom. (MG132)
SKI 1 -1.870 2.800 -1.139 -0.588
TBX18 0 0.560 -0.160
WLS 0 -0.540 1.290
RNF2 0 0.560 -0.930 -0.061 -0.694 0.392 0.384 0.526
CTNNB1 0 0.490 -0.230
CTNNB1 0 0.490 -0.230 -0.415 0.628 0.215
LDB1 0 0.670 -0.650 -1.168

PTM Sites:

Back to Protein Results
Gene name PTM type PTM site UV UV (MG132) Sequence
CTNNB1 Ubiquitylation K158 -1.265 _AIPELTK(gl)LLNDEDQVVVNK_
CTNNB1 Ubiquitylation K180 -0.546 -0.636 _AAVM(ox)VHQLSK(gl)K_
CTNNB1 Ubiquitylation K181 -0.717 -0.729 _AAVMVHQLSKK(gl)_
CTNNB1 Phosphorylation S191 -0.024 0.129 _S(ph)PQMVSAIVR_
CTNNB1 Ubiquitylation K435 -0.350 _NK(gl)MM(ox)VCQVGGIEALVR_
CTNNB1 Ubiquitylation K496 -1.262 _LHYGLPVVVK(gl)_
CTNNB1 Phosphorylation S552 1.233 1.224 _RTS(ph)MGGTQQQFVEGVR_
CTNNB1 Phosphorylation T556 1.275 0.995 _RTSM(ox)GGT(ph)QQQFVEGVR_
CTNNB1 Ubiquitylation K671 -0.941 -0.934 _MSEDKPQDYK(gl)K_
LDB1 Ubiquitylation K76 -0.052 _IFELNK(gl)R_
LDB1 Ubiquitylation K271 -0.154 _DCLK(gl)TCLFQK_
LDB1 Ubiquitylation K277 -1.611 -0.630 _TCLFQK(gl)WQR_
LDB1 Phosphorylation S323 -0.402 -0.031 _KS(ph)PASTFALSSQVPDVMVVGEPTLMGGEFGDEDER_
RNF2 Ubiquitylation K65 0.105 _NTMTTK(gl)ECLHR_
RNF2 Ubiquitylation K275 1.064 _SK(gl)GESNQMNLDTASEK_
SKI Ubiquitylation K294 -0.126 -0.054 _AYILLSQDYTGK(gl)EEQAR_
SKI Ubiquitylation K365 -0.244 -0.390 _TLAGSSNK(gl)SLGCVHPR_
SKI Phosphorylation S431 -0.475 _VVS(ph)SPPCAAAVSR_
SKI Phosphorylation S432 -0.742 -0.438 _VVSS(ph)PPCAAAVSR_
SKI Phosphorylation S480 -1.160 -1.491 _LTVDTPGAPETLAPVAAPEEDKDS(ph)EAEVEVESR_
TBX18 Ubiquitylation K326 0.687 _NPFAK(gl)GFR_
WLS Ubiquitylation K13 0.869 _AGAIIENMSTKK(gl)_
WLS Ubiquitylation K168 0.058 _CTFTSPK(gl)TPEHEGR_
WLS Ubiquitylation K206 -0.013 _LPVNEK(gl)K_
WLS Ubiquitylation K207 -2.023 _LPVNEKK(gl)_
WLS Ubiquitylation K217 -1.452 0.710 _INVGIGEIK(gl)DIR_
WLS Ubiquitylation K410 0.878 _NISGK(gl)QSSLPAMSK_
WLS Ubiquitylation K419 -1.101 0.564 _QSSLPAMSK(gl)VR_


© Copyright Svejstrup Laboratory 2015