bioLOGIC Data » bioLOGIC CategoryView » bioLOGIC VennView » Experimental Details »
bioLOGIC Category

Results for the Category
LIM domain binding
(GO:0030274)

RNAi screen result RNAPII IP (MG132) CSB IP CSB IP (MG132) Chrom. Chrom. (MG132) Ubi /Phospo Ubi /Phospho (MG132)
W

Protein Results:

Results for post-translational modifications (below)
Gene name MGoogle Score RNAi high RNAi low RNAPII-IP (MG132) CSB-IP CSB-IP (MG132) Chrom. Chrom. (MG132)
ACTN2 3 -1.480 2.640 0.936 1.929 -1.407 0.572 0.293
ACTN2 3 -1.480 2.640 0.790 0.055 0.246
RIPK2 1 -1.740 3.580
TLN1 1 -0.130 0.000 0.807 0.246 0.137
LDB2 0 -1.168
LDB1 0 0.670 -0.650 -1.168

PTM Sites:

Back to Protein Results
Gene name PTM type PTM site UV UV (MG132) Sequence
ACTN2 Ubiquitylation K125 1.906 _ALDFIASKGVK(gl)_
ACTN2 Ubiquitylation K350 0.585 _VQEK(gl)CQLEINFNTLQTK_
ACTN2 Ubiquitylation K417 0.789 _LDHLAEK(gl)FR_
ACTN2 Ubiquitylation K592 -0.644 0.678 _EAILAIHK(gl)EAQR_
ACTN2 Ubiquitylation K760 0.273 1.507 _DAK(gl)GISQEQMQEFR_
LDB1 Ubiquitylation K76 -0.052 _IFELNK(gl)R_
LDB1 Ubiquitylation K271 -0.154 _DCLK(gl)TCLFQK_
LDB1 Ubiquitylation K277 -1.611 -0.630 _TCLFQK(gl)WQR_
LDB1 Phosphorylation S323 -0.402 -0.031 _KS(ph)PASTFALSSQVPDVMVVGEPTLMGGEFGDEDER_
LDB2 Ubiquitylation K76 -0.052 _IFELNK(gl)R_
LDB2 Ubiquitylation K271 -0.154 _DCLK(gl)TCLFQK_
LDB2 Ubiquitylation K277 -1.611 -0.630 _TCLFQK(gl)WQR_
LDB2 Phosphorylation S323 -0.402 -0.031 _KS(ph)PASTFALSSQVPDVMVVGEPTLMGGEFGDEDER_
RIPK2 Ubiquitylation K410 -2.810 _AAFCDHK(gl)TTPCSSAIINPLSTAGNSER_
RIPK2 Phosphorylation S531 0.884 0.839 _SPS(ph)LNLLQNK_
RIPK2 Ubiquitylation K538 -2.659 _SPSLNLLQNK(gl)SM_
TLN1 Ubiquitylation K334 -0.489 0.561 _LLGITK(gl)ECVM(ox)R_
TLN1 Phosphorylation S423 0.105 _DHFGLEGDEESTMLEDS(ph)VSPKK_
TLN1 Phosphorylation S425 -0.366 -0.322 _DHFGLEGDEESTMLEDSVS(ph)PKK_
TLN1 Ubiquitylation K869 -0.260 _ILADATAK(gl)MVEAAK_
TLN1 Ubiquitylation K1541 0.365 2.311 _EVANSTANLVK(gl)TIK_
TLN1 Ubiquitylation K2021 0.309 0.479 _EGILK(gl)TAK_


© Copyright Svejstrup Laboratory 2015