bioLOGIC Data » bioLOGIC CategoryView » bioLOGIC VennView » Experimental Details »

bioLOGIC Data

bioLOGIC Data


Exact search


Query: LDB2

RNAi screen result RNAPII IP (PI) CSB IP CSB IP (PI) Chrom. Chrom. (PI) Phosphorylation Ubiquitylation
W
[Click on the plots to view the data selection in the respective scatterplot]

Protein Results:

 Results for post-translational modifications: see below | Red/green: hit at lower/upper end of the respective screen
Gene name Point score Z-score sums RNAi high RNAi low RNAPII-IP (PI) CSB-IP CSB-IP (PI) Chrom. Chrom. (PI)
LDB2 0 -3.264 -1.168

PTM Sites:

 Back to Protein Results | Red/green: hit at lower/upper end of the respective screen
Gene name PTM type PTM site UV UV (PI) Sequence
LDB2 Phosphorylation S323 -0.402 -0.031 _KS(ph)PASTFALSSQVPDVMVVGEPTLMGGEFGDEDER_
LDB2 Ubiquitylation K76 -0.052 _IFELNK(gl)R_
LDB2 Ubiquitylation K271 -0.154 _DCLK(gl)TCLFQK_
LDB2 Ubiquitylation K277 -1.611 -0.630 _TCLFQK(gl)WQR_

Background Information for LDB2:


Pubmed-LDB2 »
Uniprot-LDB2 »
Biogrid-LDB2 »
ProteomicsDB-LDB2 »

Tumorportal-LDB2 »
COSMIC-LDB2 »
GenomeRNAi-LDB2 »
Genecards-LDB2


Protein-protein Interactions for LDB2
Show screen data for Category Name and Description Link to cat description Data Source


Protein Domains in LDB2
Domain name Domain Description TC-NER relevance -log10(p-value)
Category members LIM-bd/SEUSS IPR029005 0.32


Protein complexes (CORUM database) featuring LDB2
Category Type Category ID Category Name Data Source TC-NER relevance -log10(p-value)


Categories featuring LDB2
Category Type Category ID Category Name Data Source TC-NER relevance -log10(p-value)
Category members GO Category GO:0005515 protein binding Database INF
Category members GO Category GO:0005634 nucleus Database INF
Category members GO Category GO:0019899 enzyme binding Database 1.57
Category members GO Category GO:0010669 epithelial structure maintenance Database 0.36
Category members GO Category GO:0003712 transcription cofactor activity Database 0.21
Category members GO Category GO:0005667 transcription factor complex Database 0.19
Category members GO Category GO:0045944 positive regulation of transcription from RNA polymerase II promoter Database 0.13
Category members GO Category GO:0000989 transcription factor binding transcription factor activity Database 0.01
Category members GO Category GO:0001942 hair follicle development Database 0
Category members GO Category GO:0030274 LIM domain binding Database 0
Category members GO Category GO:0035019 somatic stem cell maintenance Database 0


.

© Copyright Svejstrup Laboratory 2015