bioLOGIC Data » bioLOGIC CategoryView » bioLOGIC VennView » Experimental Details »
bioLOGIC Category

Results for the Category
positive regulation of hemoglobin biosynthetic process
(GO:0046985)

RNAi screen result RNAPII IP (MG132) CSB IP CSB IP (MG132) Chrom. Chrom. (MG132) Ubi /Phospo Ubi /Phospho (MG132)
W

Protein Results:

Results for post-translational modifications (below)
Gene name MGoogle Score RNAi high RNAi low RNAPII-IP (MG132) CSB-IP CSB-IP (MG132) Chrom. Chrom. (MG132)
LDB1 0 0.670 -0.650 -1.168

PTM Sites:

Back to Protein Results
Gene name PTM type PTM site UV UV (MG132) Sequence
LDB1 Ubiquitylation K76 -0.052 _IFELNK(gl)R_
LDB1 Ubiquitylation K271 -0.154 _DCLK(gl)TCLFQK_
LDB1 Ubiquitylation K277 -1.611 -0.630 _TCLFQK(gl)WQR_
LDB1 Phosphorylation S323 -0.402 -0.031 _KS(ph)PASTFALSSQVPDVMVVGEPTLMGGEFGDEDER_


© Copyright Svejstrup Laboratory 2015