bioLOGIC Data » bioLOGIC CategoryView » bioLOGIC VennView » Experimental Details »

bioLOGIC Category

Results for the Category
RNA polymerase II activating transcription factor binding
(GO:0001102)

RNAi screen result RNAPII IP (MG132) CSB IP CSB IP (MG132) Chrom. Chrom. (MG132) Ubi /Phospo Ubi /Phospho (MG132)
W

Protein Results:

 Results for post-translational modifications (below)
Gene name MGoogle Score RNAi high RNAi low RNAPII-IP (MG132) CSB-IP CSB-IP (MG132) Chrom. Chrom. (MG132)
JUN 3 -0.930 0.930 -0.126
TP53BP1 2 -1.490 1.970 -0.161 -0.160 0.174
TP53BP1 2 -1.490 1.970 0.638 0.558
ATF2 2 -1.380 1.800
SETD3 1 -0.570 0.790 4.968 0.048
CREBBP 0 0.840 -0.950 -3.889 -1.071
HIPK2 0 -0.990 0.680
EP300 0 -1.210 1.320 -1.089 -1.694 -0.723
NFE2L2 0 1.610 -1.200
MAD2L2 0 -0.960 1.170
CREB1 0 1.080 -0.800 -1.027
BEX1 0 1.430 -1.040
BHLHE40 0 -0.330 0.040
TBX3 0 -0.160 0.160
RB1 0 1.180 -1.070 0.429 0.755
RB1 0 1.180 -1.070
NCOR1 0 -0.820 1.130 -0.827 -0.215 0.037
T 0 0.200 -0.340 -0.755
SMAD3 0 -1.560 1.800
SMAD3 0 0.270 -0.340
CTNNB1 0 0.490 -0.230
CTNNB1 0 0.490 -0.230 -0.415 0.628 0.215
SIN3A 0 -0.610 0.780 0.378 -0.208 0.304 -0.168 0.410
ZFPM1 0 -0.320 0.140
LDB1 0 0.670 -0.650 -1.168

PTM Sites:

 Back to Protein Results
Gene name PTM type PTM site UV UV (MG132) Sequence
ATF2 Phosphorylation T71 -1.263 -1.166 _NDSVIVADQTPT(ph)PTR_
ATF2 Phosphorylation S90 2.624 2.389 _NCEEVGLFNELAS(ph)PFENEFKK_
ATF2 Phosphorylation S112 1.025 1.118 _MPLDLS(ph)PLATPIIR_
BEX1 Ubiquitylation K130 -1.968 0.603 _QLMEK(gl)LR_
BEX1 Ubiquitylation K134 -1.057 0.454 _EK(gl)QLSHSLR_
BHLHE40 Ubiquitylation K159 -0.521 _EVLQYLAK(gl)HENTR_
BHLHE40 Ubiquitylation K262 -1.135 _SEQPCFK(gl)SDHGR_
BHLHE40 Phosphorylation S383 -2.162 _LPS(ph)PLPAHPSVDSSVLLQALKPIPPLNLETKD_
CREB1 Phosphorylation S271 -0.979 -1.450 _TAPTSTIAPGVVM(ox)ASS(ph)PALPTQPAEEAAR_
CREB1 Ubiquitylation K333 1.343 _ALK(gl)DLYCHK_
CREBBP Phosphorylation S2093 0.037 0.097 _SIS(ph)PSALQDLLR_
CTNNB1 Ubiquitylation K158 -1.265 _AIPELTK(gl)LLNDEDQVVVNK_
CTNNB1 Ubiquitylation K180 -0.546 -0.636 _AAVM(ox)VHQLSK(gl)K_
CTNNB1 Ubiquitylation K181 -0.717 -0.729 _AAVMVHQLSKK(gl)_
CTNNB1 Phosphorylation S191 -0.024 0.129 _S(ph)PQMVSAIVR_
CTNNB1 Ubiquitylation K435 -0.350 _NK(gl)MM(ox)VCQVGGIEALVR_
CTNNB1 Ubiquitylation K496 -1.262 _LHYGLPVVVK(gl)_
CTNNB1 Phosphorylation S552 1.233 1.224 _RTS(ph)MGGTQQQFVEGVR_
CTNNB1 Phosphorylation T556 1.275 0.995 _RTSM(ox)GGT(ph)QQQFVEGVR_
CTNNB1 Ubiquitylation K671 -0.941 -0.934 _MSEDKPQDYK(gl)K_
EP300 Phosphorylation S1038 -0.672 -0.349 _TEIKEEEDQPSTSATQSS(ph)PAPGQSK_
EP300 Phosphorylation S1726 0.994 0.627 _LGLGLDDESNNQQAAATQS(ph)PGDSRR_
EP300 Phosphorylation S2328 -1.092 0.725 _PQSQPPHSSPS(ph)PR_
HIPK2 Ubiquitylation K492 -0.060 _YISQTQGLPAEYLLSAGTK(gl)TTR_
HIPK2 Ubiquitylation K614 -0.350 _SCFQNMEICK(gl)R_
JUN Phosphorylation S58 -0.167 -1.247 _AKNS(ph)DLLTSPDVGLLK_
JUN Phosphorylation T62 2.545 1.674 _NSDLLT(ph)SPDVGLLK_
JUN Phosphorylation S63 2.030 1.458 _NSDLLTS(ph)PDVGLLK_
JUN Ubiquitylation K70 9.213 _NSDLLTSPDVGLLK(gl)_
JUN Phosphorylation S73 1.499 0.845 _LAS(ph)PELER_
JUN Phosphorylation S243 -0.642 -1.399 _LQALKEEPQTVPEMPGETPPLS(ph)PIDMESQER_
JUN Ubiquitylation K309 1.034 0.155 _EQVAQLK(gl)QK_
LDB1 Ubiquitylation K76 -0.052 _IFELNK(gl)R_
LDB1 Ubiquitylation K271 -0.154 _DCLK(gl)TCLFQK_
LDB1 Ubiquitylation K277 -1.611 -0.630 _TCLFQK(gl)WQR_
LDB1 Phosphorylation S323 -0.402 -0.031 _KS(ph)PASTFALSSQVPDVMVVGEPTLMGGEFGDEDER_
MAD2L2 Ubiquitylation K44 1.121 _EVYPVGIFQK(gl)R_
NCOR1 Phosphorylation S1195 -0.029 0.716 _MPIEDS(ph)SPEKGREEAASK_
NCOR1 Phosphorylation S1196 0.087 0.141 _MPIEDSS(ph)PEKGR_
NCOR1 Phosphorylation S1472 0.700 0.536 _AQLS(ph)PGIYDDTSAR_
NCOR1 Phosphorylation S1977 -0.959 -0.974 _YETPSDAIEVIS(ph)PASSPAPPQEK_
NCOR1 Ubiquitylation K1998 -2.086 _LQTYQPEVVK(gl)ANQAENDPTR_
NCOR1 Phosphorylation S2120 0.148 0.154 _VS(ph)PENLVDK_
NCOR1 Phosphorylation S2151 -1.006 -0.922 _SHVSSEPYEPIS(ph)PPQVPVVHEK_
NCOR1 Phosphorylation S2184 0.120 0.226 _S(ph)PGSISYLPSFFTK_
NCOR1 Phosphorylation S2187 0.396 _SPGS(ph)ISYLPSFFTK_
NFE2L2 Ubiquitylation K65 -0.831 _QEQLQK(gl)EQEK_
RB1 Phosphorylation S69 -3.602 -3.397 _TAATAAAAAAEPPAPPPPPPPEEDPEQDS(ph)GPEDLPLVR_
RB1 Ubiquitylation K97 -0.546 _LK(gl)IPDHVR_
RB1 Phosphorylation T388 0.005 0.116 _TLQTDSIDSFETQRT(ph)PR_
RB1 Phosphorylation T405 -0.851 -0.901 _KSNLDEEVNVIPPHT(ph)PVR_
RB1 Phosphorylation S820 -0.019 _S(ph)PYKFPSSPLR_
RB1 Ubiquitylation K823 -2.214 _SPYK(gl)FPSSPLR_
RB1 Phosphorylation S827 0.824 0.111 _FPSS(ph)PLR_
RB1 Phosphorylation S839 -0.701 -1.045 _IPGGNIYIS(ph)PLKS(ph)PYK_
RB1 Ubiquitylation K842 -0.751 _IPGGNIYISPLK(gl)SPYK_
RB1 Phosphorylation S843 -0.701 -0.022 _IPGGNIYIS(ph)PLKS(ph)PYK_
RB1 Ubiquitylation K846 -2.084 _SPYK(gl)ISEGLPTPTK_
RB1 Phosphorylation T853 0.039 -0.555 _ISEGLPT(ph)PTKM(ox)T(ph)PR_
RB1 Ubiquitylation K856 -1.350 _ISEGLPTPTK(gl)MTPR_
RB1 Phosphorylation T858 -0.782 0.564 _ISEGLPT(ph)PTKMT(ph)PR_
RB1 Ubiquitylation K879 -0.187 _FQK(gl)INQMVCNSDR_
SETD3 Ubiquitylation K439 -0.319 _ASLLLK(gl)TYK_
SIN3A Ubiquitylation K155 0.182 _EFK(gl)SQSIDTPGVISR_
SIN3A Phosphorylation T266 -0.572 _VSKPSQLQAHTPASQQT(ph)PPLPPYASPR_
SIN3A Phosphorylation S277 -1.598 _S(ph)PPVQPHTPVTISLGTAPSLQNNQPVEFNHAINYVNK_
SIN3A Phosphorylation S295 -1.959 _SPPVQPHTPVTISLGTAPS(ph)LQNNQPVEFNHAINYVNK_
SIN3A Ubiquitylation K638 -0.223 _VLEAIQK(gl)K_
SIN3A Ubiquitylation K639 -0.223 _VLEAIQK(gl)K_
SIN3A Ubiquitylation K715 1.012 _GFNK(gl)VWR_
SIN3A Phosphorylation S832 0.764 0.363 _GDLS(ph)DVEEEEEEEM(ox)DVDEATGAVKK_
SIN3A Ubiquitylation K875 0.131 0.003 _LLFSNTAAQK(gl)LR_
SIN3A Ubiquitylation K937 -0.224 -0.025 _DK(gl)SDSPAIQLR_
SIN3A Phosphorylation S940 -0.107 _DKSDS(ph)PAIQLR_
SIN3A Phosphorylation T1111 0.691 0.517 _YM(ox)NSDTT(ph)SPELR_
SIN3A Phosphorylation S1112 0.623 0.725 _YM(ox)NSDTTS(ph)PELR_
SMAD3 Ubiquitylation K13 -0.704 _(ac)SSILPFTPPIVK(gl)R_
TBX3 Ubiquitylation K466 -2.519 _EGTAPAK(gl)VEEAR_
TP53BP1 Phosphorylation S119 2.253 2.083 _TSS(ph)VLGMSVESAPAVEEEKGEELEQK_
TP53BP1 Phosphorylation S265 0.355 0.274 _SEDM(ox)PFS(ph)PK_
TP53BP1 Phosphorylation S280 -0.705 _EQLS(ph)AQELMESGLQIQKSPEPEVLSTQEDLFDQSNK_
TP53BP1 Phosphorylation S287 -1.294 -1.483 _EQLSAQELMES(ph)GLQIQKSPEPEVLSTQEDLFDQSNK_
TP53BP1 Phosphorylation S294 -1.218 -0.875 _S(ph)PEPEVLSTQEDLFDQSNK_
TP53BP1 Phosphorylation S379 -0.210 _STPFIVPS(ph)SPTEQEGR_
TP53BP1 Phosphorylation S380 -0.036 -0.182 _STPFIVPSS(ph)PTEQEGR_
TP53BP1 Phosphorylation T382 -0.167 _STPFIVPSSPT(ph)EQEGR_
TP53BP1 Phosphorylation S500 0.214 0.591 _NS(ph)PEDLGLSLTGDSCK_
TP53BP1 Phosphorylation S525 -0.547 _LM(ox)LSTSEYSQS(ph)PK_
TP53BP1 Phosphorylation S552 0.102 0.080 _IDEDGENTQIEDTEPMS(ph)PVLNSK_
TP53BP1 Phosphorylation S580 1.645 1.855 _FVPAENDSILMNPAQDGEVQLS(ph)QNDDKTK_
TP53BP1 Phosphorylation S771 0.885 _VDVS(ph)CEPLEGVEK_
TP53BP1 Phosphorylation S831 2.288 2.726 _SGTAETEPVEQDSS(ph)QPSLPLVR_
TP53BP1 Phosphorylation T922 1.634 _EGDIIPPLTGAT(ph)PPLIGHLK_
TP53BP1 Phosphorylation S993 2.280 _LVS(ph)PETEASEESLQFNLEKPATGER_
TP53BP1 Phosphorylation S1028 0.901 0.869 _NGSTAVAESVAS(ph)PQK_
TP53BP1 Phosphorylation T1055 1.132 0.932 _SEDPPT(ph)TPIR_
TP53BP1 Phosphorylation T1056 0.818 0.172 _SEDPPTT(ph)PIR_
TP53BP1 Phosphorylation S1067 3.036 2.786 _GNLLHFPS(ph)SQGEEEKEK_
TP53BP1 Phosphorylation S1068 2.467 3.424 _GNLLHFPSS(ph)QGEEEKEKLEGDHTIR_
TP53BP1 Phosphorylation S1094 -1.038 _QSQQPMKPIS(ph)PVKDPVS(ph)PASQK_
TP53BP1 Phosphorylation S1101 -1.038 _QSQQPMKPIS(ph)PVKDPVS(ph)PASQK_
TP53BP1 Phosphorylation S1113 0.104 0.162 _MVIQGPS(ph)SPQGEAMVTDVLEDQK_
TP53BP1 Phosphorylation S1114 0.438 0.116 _M(ox)VIQGPSS(ph)PQGEAM(ox)VTDVLEDQK_
TP53BP1 Phosphorylation S1317 1.156 1.461 _TSS(ph)GTSLSAMHSSGSSGK_
TP53BP1 Phosphorylation S1362 0.462 0.439 _GGPGKLS(ph)PR_
TP53BP1 Phosphorylation S1426 -0.275 0.340 _ETAVPGPLGIEDIS(ph)PNLSPDDK_
TP53BP1 Phosphorylation S1430 -0.558 -0.362 _ETAVPGPLGIEDISPNLS(ph)PDDK_
TP53BP1 Phosphorylation S1460 -0.626 -0.602 _RS(ph)DSPEIPFQAAAGPSDGLDASSPGNSFVGLR_
TP53BP1 Phosphorylation S1462 -1.029 -0.981 _RSDS(ph)PEIPFQAAAGPSDGLDASSPGNSFVGLR_
TP53BP1 Phosphorylation S1618 -0.090 _AADIS(ph)LDNLVEGK_
TP53BP1 Phosphorylation S1673 -0.238 -0.008 _LITS(ph)EEERS(ph)PAK_
TP53BP1 Phosphorylation S1678 -0.242 -0.396 _LITSEEERS(ph)PAK_
ZFPM1 Phosphorylation S663 -0.923 _GS(ph)EGSQSPGSSVDDAEDDPSR_
ZFPM1 Phosphorylation S666 -0.794 _GSEGS(ph)QSPGSSVDDAEDDPSR_
ZFPM1 Phosphorylation S668 -0.575 -1.556 _GSEGSQS(ph)PGSSVDDAEDDPSR_
ZFPM1 Phosphorylation S786 -0.527 _S(ph)PGPAADGPIDLSK_


.

© Copyright Svejstrup Laboratory 2015