bioLOGIC Data » bioLOGIC CategoryView » bioLOGIC VennView » Experimental Details »

bioLOGIC Data

bioLOGIC Data


Exact search


Query: TP53BP1

This is a cancer-associated gene according to the Broad cancer gene census.

RNAi screen result RNAPII IP (PI) CSB IP CSB IP (PI) Chrom. Chrom. (PI) Phosphorylation Ubiquitylation
W
[Click on the plots to view the data selection in the respective scatterplot]

Protein Results:

 Results for post-translational modifications: see below | Red/green: hit at lower/upper end of the respective screen
Gene name Point score Z-score sums RNAi high RNAi low RNAPII-IP (PI) CSB-IP CSB-IP (PI) Chrom. Chrom. (PI)
TP53BP1 2 9.479 -1.490 1.970 0.638 0.558
TP53BP1 2 9.479 -1.490 1.970 -0.161 -0.160 0.174

PTM Sites:

 Back to Protein Results | Red/green: hit at lower/upper end of the respective screen
Gene name PTM type PTM site UV UV (PI) Sequence
TP53BP1 Phosphorylation S1068 2.467 3.424 _GNLLHFPSS(ph)QGEEEKEKLEGDHTIR_
TP53BP1 Phosphorylation S1067 3.036 2.786 _GNLLHFPS(ph)SQGEEEKEK_
TP53BP1 Phosphorylation S831 2.288 2.726 _SGTAETEPVEQDSS(ph)QPSLPLVR_
TP53BP1 Phosphorylation S993 2.280 _LVS(ph)PETEASEESLQFNLEKPATGER_
TP53BP1 Phosphorylation S119 2.253 2.083 _TSS(ph)VLGMSVESAPAVEEEKGEELEQK_
TP53BP1 Phosphorylation S580 1.645 1.855 _FVPAENDSILMNPAQDGEVQLS(ph)QNDDKTK_
TP53BP1 Phosphorylation S1317 1.156 1.461 _TSS(ph)GTSLSAMHSSGSSGK_
TP53BP1 Phosphorylation T1055 1.132 0.932 _SEDPPT(ph)TPIR_
TP53BP1 Phosphorylation S771 0.885 _VDVS(ph)CEPLEGVEK_
TP53BP1 Phosphorylation S1028 0.901 0.869 _NGSTAVAESVAS(ph)PQK_
TP53BP1 Phosphorylation S500 0.214 0.591 _NS(ph)PEDLGLSLTGDSCK_
TP53BP1 Phosphorylation S1362 0.462 0.439 _GGPGKLS(ph)PR_
TP53BP1 Phosphorylation S1426 -0.275 0.340 _ETAVPGPLGIEDIS(ph)PNLSPDDK_
TP53BP1 Phosphorylation S265 0.355 0.274 _SEDM(ox)PFS(ph)PK_
TP53BP1 Phosphorylation T1056 0.818 0.172 _SEDPPTT(ph)PIR_
TP53BP1 Phosphorylation S1113 0.104 0.162 _MVIQGPS(ph)SPQGEAMVTDVLEDQK_
TP53BP1 Phosphorylation S1114 0.438 0.116 _M(ox)VIQGPSS(ph)PQGEAM(ox)VTDVLEDQK_
TP53BP1 Phosphorylation S552 0.102 0.080 _IDEDGENTQIEDTEPMS(ph)PVLNSK_
TP53BP1 Phosphorylation S1673 -0.238 -0.008 _LITS(ph)EEERS(ph)PAK_
TP53BP1 Phosphorylation S380 -0.036 -0.182 _STPFIVPSS(ph)PTEQEGR_
TP53BP1 Phosphorylation S379 -0.210 _STPFIVPS(ph)SPTEQEGR_
TP53BP1 Phosphorylation S1430 -0.558 -0.362 _ETAVPGPLGIEDISPNLS(ph)PDDK_
TP53BP1 Phosphorylation S1678 -0.242 -0.396 _LITSEEERS(ph)PAK_
TP53BP1 Phosphorylation S1460 -0.626 -0.602 _RS(ph)DSPEIPFQAAAGPSDGLDASSPGNSFVGLR_
TP53BP1 Phosphorylation S280 -0.705 _EQLS(ph)AQELMESGLQIQKSPEPEVLSTQEDLFDQSNK_
TP53BP1 Phosphorylation S294 -1.218 -0.875 _S(ph)PEPEVLSTQEDLFDQSNK_
TP53BP1 Phosphorylation S1462 -1.029 -0.981 _RSDS(ph)PEIPFQAAAGPSDGLDASSPGNSFVGLR_
TP53BP1 Phosphorylation S1094 -1.038 _QSQQPMKPIS(ph)PVKDPVS(ph)PASQK_
TP53BP1 Phosphorylation S1101 -1.038 _QSQQPMKPIS(ph)PVKDPVS(ph)PASQK_
TP53BP1 Phosphorylation S287 -1.294 -1.483 _EQLSAQELMES(ph)GLQIQKSPEPEVLSTQEDLFDQSNK_
TP53BP1 Phosphorylation T382 -0.167 _STPFIVPSSPT(ph)EQEGR_
TP53BP1 Phosphorylation S525 -0.547 _LM(ox)LSTSEYSQS(ph)PK_
TP53BP1 Phosphorylation T922 1.634 _EGDIIPPLTGAT(ph)PPLIGHLK_
TP53BP1 Phosphorylation S1618 -0.090 _AADIS(ph)LDNLVEGK_

Background Information for TP53BP1:


Pubmed-TP53BP1 »
Uniprot-TP53BP1 »
Biogrid-TP53BP1 »
ProteomicsDB-TP53BP1 »

Tumorportal-TP53BP1 »
COSMIC-TP53BP1 »
GenomeRNAi-TP53BP1 »
Genecards-TP53BP1


Protein-protein Interactions for TP53BP1
Show screen data for Category Name and Description Link to cat description Data Source
Category members IP bait C9orf126;SCAI Cat. description Hein, Mann, Cell 2015
Category members IP bait CENPF Cat. description Hein, Mann, Cell 2015
Category members IP bait DYNLL1 Cat. description Hein, Mann, Cell 2015
Category members IP bait SMC6 Cat. description Hein, Mann, Cell 2015
Category members IP bait TP53BP1 Cat. description Hein, Mann, Cell 2015
Category members IP bait MRPS7 Cat. description BioPlex, Huttlin, Gygi, Cell 2015
Category members IP bait NUDT16L1 Cat. description BioPlex, Huttlin, Gygi, Cell 2015
Category members IP bait NUP50 Cat. description BioPlex, Huttlin, Gygi, Cell 2015
Category members IP bait THAP10 Cat. description BioPlex, Huttlin, Gygi, Cell 2015


Protein Domains in TP53BP1
Domain name Domain Description TC-NER relevance -log10(p-value)
Category members BRCT_dom IPR001357 1.59


Protein complexes (CORUM database) featuring TP53BP1
Category Type Category ID Category Name Data Source TC-NER relevance -log10(p-value)
Category members Corum 5231 53BP1-containing complex Database 1.75
Category members Corum 5197 PTIP-DNA damage response complex Database 0.94
Category members Corum 2775 MDC1-p53BP1-SMC1 complex Database 0.91
Category members Corum 2774 MDC1-H2AFX-TP53BP1 complex Database 0.66


Categories featuring TP53BP1
Category Type Category ID Category Name Data Source TC-NER relevance -log10(p-value)
Category members GO Category GO:0005515 protein binding Database INF
Category members GO Category GO:0005634 nucleus Database INF
Category members GO Category GO:0005654 nucleoplasm Database INF
Category members GO Category GO:0006281 DNA repair Database INF
Category members GO Category GO:0005737 cytoplasm Database 12.81
Category members Pathway Pathway_338 REACTOME_DNA_REPAIR 0 8.18
Category members GO Category GO:0006302 double-strand break repair Database 4.62
Category members GO Category GO:0003684 damaged DNA binding Database 4.54
Category members Pathway Pathway_861 REACTOME_DOUBLE_STRAND_BREAK_REPAIR 0 4.5
Category members Pathway Pathway_978 PID_ATM_PATHWAY 0 4.31
Category members GO Category GO:0006974 cellular response to DNA damage stimulus Database 3.57
Category members Pathway Pathway_862 REACTOME_HOMOLOGOUS_RECOMBINATION_REPAIR_OF_REPLICATION_INDEPENDENT_DOUBLE_STRAND_BREAKS 0 3
Category members GO Category GO:0000724 double-strand break repair via homologous recombination Database 2.41
Category members GO Category GO:0000776 kinetochore Database 2.24
Category members GO Category GO:0002039 p53 binding Database 2.06
Category members GO Category GO:0042162 telomeric DNA binding Database 1.23
Category members Human mutations Broad_cancer_genes Broad cancer genes (Lawrence et al., 2014) literature 1.14
Category members GO Category GO:0005657 replication fork Database 0.95
Category members GO Category GO:0035064 methylated histone residue binding Database 0.53
Category members GO Category GO:0000777 condensed chromosome kinetochore Database 0.32
Category members GO Category GO:0001102 RNA polymerase II activating transcription factor binding Database 0.31
Category members GO Category GO:0045893 positive regulation of transcription, DNA-dependent Database 0.28
Category members GO Category GO:0000781 chromosome, telomeric region Database 0.16
Category members GO Category GO:0045944 positive regulation of transcription from RNA polymerase II promoter Database 0.13
Category members GO Category GO:0001104 RNA polymerase II transcription cofactor activity Database 0.08
Category members GO Category GO:0051091 positive regulation of sequence-specific DNA binding transcription factor activity Database 0


.

© Copyright Svejstrup Laboratory 2015