bioLOGIC Data » bioLOGIC CategoryView » bioLOGIC VennView » Experimental Details »

bioLOGIC Category

Results for the Category
RNA polymerase II transcription cofactor activity
(GO:0001104)

RNAi screen result RNAPII IP (MG132) CSB IP CSB IP (MG132) Chrom. Chrom. (MG132) Ubi /Phospo Ubi /Phospho (MG132)
W

Protein Results:

 Results for post-translational modifications (below)
Gene name MGoogle Score RNAi high RNAi low RNAPII-IP (MG132) CSB-IP CSB-IP (MG132) Chrom. Chrom. (MG132)
THRAP3 3 1.430 -0.880 0.813 -0.969 0.662 0.407 0.317
TP53BP1 2 -1.490 1.970 -0.161 -0.160 0.174
TP53BP1 2 -1.490 1.970 0.638 0.558
MED24 1 -1.120 1.330 -0.351 -0.190 0.792 -0.333
MED17 1 0.700 -0.990 -1.647 1.651 -0.170 -0.346
MED26 1 0.500 -1.120
MED20 1 2.740 -1.100 -0.895
MED1 1 0.780 -0.520 -1.530 -0.219
MED4 1 -1.480 2.730
TDG 1 1.400 -0.150
MED8 1 -0.200 -0.330 -3.450
MED30 1 2.100 -1.330
MED14 1 -0.700 0.420 -2.483 0.951 1.842 -1.302 -0.509
MED13 0 0.640 -0.690
CNOT2 0 -1.010 0.910
CNOT2 0 -0.480 -0.280
MED13L 0 -0.540 0.950
TRERF1 0
MED18 0
MED10 0
MED6 0 0.150 -0.220 -2.260
MED9 0 -0.470 -0.150
MED12L 0 0.560 -0.390 -1.501 -0.491
PPARGC1B 0 0.740 -0.460
MED11 0
NKX2-5 0 -0.150 1.230 0.174 0.236
NKX2-5 0 -0.150 1.230 -0.123
MED12 0 -0.180 -0.500 -1.501 -0.491
RBM14 0 -0.750 1.640 -0.862 -1.197 -0.121 0.758 0.178
RBM14 0 0.230 -0.290 -0.862 -1.197 -0.121 0.758 0.178

PTM Sites:

 Back to Protein Results
Gene name PTM type PTM site UV UV (MG132) Sequence
CNOT2 Phosphorylation S80 -0.345 0.395 _TNSMSSSGLGS(ph)PNR_
MED1 Phosphorylation S664 3.368 _DNPAQDFSTLYGSS(ph)PLER_
MED1 Phosphorylation S771 -1.422 _LSS(ph)SDSIGPDVTDILSDIAEEASKLPSTSDDCPAIGTPLR_
MED1 Phosphorylation T1051 -1.201 -1.247 _SQT(ph)PPGVATPPIPK_
MED1 Phosphorylation T1057 -1.294 _SQT(ph)PPGVAT(ph)PPIPK_
MED1 Phosphorylation S1155 0.689 _NSSQSGGKPGS(ph)SPITK_
MED1 Phosphorylation S1156 0.829 1.055 _NSSQSGGKPGSS(ph)PITK_
MED1 Phosphorylation S1192 -0.792 _PSSLM(ox)NPSLSKPNIS(ph)PSHSRPPGGSDK_
MED1 Phosphorylation S1223 1.061 1.013 _AKS(ph)PISSGSGGSHM(ox)SGTSSSSGM(ox)K_
MED1 Phosphorylation S1433 -0.191 _NYGS(ph)PLISGSTPK_
MED10 Ubiquitylation K4 -1.822 -1.288 _(ac)AEK(gl)FDHLEEHLEK_
MED10 Ubiquitylation K53 -0.830 0.455 _LNFIVTGLQDIDK(gl)CR_
MED10 Ubiquitylation K82 -1.856 -0.301 _NPQLYTK(gl)ECLER_
MED10 Ubiquitylation K91 0.241 _ALAK(gl)NEQVK_
MED10 Ubiquitylation K98 -1.357 _GK(gl)IDTMKK_
MED10 Ubiquitylation K104 -0.971 _GKIDTMKK(gl)_
MED10 Ubiquitylation K106 0.002 _FK(gl)SLLIQELSK_
MED11 Ubiquitylation K103 -0.026 _LK(gl)LSDVAR_
MED12 Ubiquitylation K429 -0.439 _EIEQQIK(gl)ER_
MED12 Ubiquitylation K531 -0.272 _AMVVAKLLEK(gl)_
MED12 Phosphorylation S635 -1.278 -0.801 _GDLAFGAPGPRPPS(ph)PFDDPADDPEHK_
MED12 Ubiquitylation K1001 -1.092 _VK(gl)NTIYCNVEPSESNMR_
MED12 Ubiquitylation K1661 -1.781 _DVITCEPQGSLIDTK(gl)GNK_
MED12 Ubiquitylation K1682 -0.745 _EGLQVSTK(gl)QK_
MED12 Ubiquitylation K1684 -0.960 _EGLQVSTK(gl)QK_
MED12L Ubiquitylation K429 -0.439 _EIEQQIK(gl)ER_
MED12L Ubiquitylation K531 -0.272 _AMVVAKLLEK(gl)_
MED12L Phosphorylation S635 -1.278 -0.801 _GDLAFGAPGPRPPS(ph)PFDDPADDPEHK_
MED12L Ubiquitylation K1001 -1.092 _VK(gl)NTIYCNVEPSESNMR_
MED12L Ubiquitylation K1661 -1.781 _DVITCEPQGSLIDTK(gl)GNK_
MED12L Ubiquitylation K1682 -0.745 _EGLQVSTK(gl)QK_
MED12L Ubiquitylation K1684 -0.960 _EGLQVSTK(gl)QK_
MED13 Phosphorylation S890 0.092 _IEVDEGFCS(ph)PKPSEIK_
MED13 Ubiquitylation K1890 0.843 _NLQSLSK(gl)R_
MED13L Phosphorylation S817 -0.258 _AGSSSLTQVTDLAPSLHDLDNIFDNS(ph)DDDELGAVSPALR_
MED13L Phosphorylation S923 0.430 0.314 _MEVEDGLGS(ph)PKPEEIKDFSYVHK_
MED14 Ubiquitylation K176 -0.354 _DK(gl)IIPPDPITK_
MED14 Ubiquitylation K487 0.044 _SVNDDMK(gl)R_
MED14 Ubiquitylation K699 -0.410 _GITEETQK(gl)ALDR_
MED14 Phosphorylation S986 -1.229 -1.699 _SVNEDDNPPS(ph)PIGGDM(ox)MDSLISQLQPPPQQQPFPK_
MED14 Ubiquitylation K1256 -1.340 _VALSPK(gl)TNQTLQLK_
MED18 Ubiquitylation K103 0.627 _YLGQPEMGDK(gl)NR_
MED20 Ubiquitylation K106 -0.176 _GFFQSAK(gl)ASK_
MED20 Ubiquitylation K202 -0.568 _K(gl)QQQVPVAGIR_
MED24 Phosphorylation S862 1.164 0.238 _LLS(ph)SNEDDANILSS(ph)PTDR_
MED24 Phosphorylation S863 2.413 _LLSS(ph)NEDDANILSS(ph)PTDR_
MED24 Phosphorylation S873 0.174 0.861 _LLSSNEDDANILSS(ph)PTDR_
MED26 Phosphorylation S7 -0.245 -0.270 _(ac)TAAPAS(ph)PQQIR_
MED26 Phosphorylation S361 1.616 _AGLS(ph)PAEPLLSR_
MED26 Phosphorylation S447 -0.042 _EPVRADS(ph)PVHMEQQSR_
MED30 Phosphorylation S2 -0.188 -0.097 _(ac)S(ph)TPPLAASGMAPGPFAGPQAQQAAR_
MED30 Phosphorylation T3 -0.188 -0.624 _(ac)ST(ph)PPLAASGMAPGPFAGPQAQQAAR_
MED4 Ubiquitylation K112 0.878 _DSDIQQLQK(gl)QLK_
MED4 Ubiquitylation K150 -0.369 _KGAISSEEIIK(gl)YAHR_
MED6 Ubiquitylation K51 -0.146 _TCNNEVVK(gl)MQR_
MED8 Phosphorylation S82 1.556 1.306 _NQVIIPLVLS(ph)PDRDEDLM(ox)R_
MED9 Ubiquitylation K134 -1.629 _TKNELLQK(gl)YK_
PPARGC1B Phosphorylation S524 0.617 _ELGS(ph)PTDEDSGQDQQLLR_
RBM14 Ubiquitylation K149 -0.268 -0.370 _RINVELSTK(gl)GQK_
RBM14 Ubiquitylation K152 0.374 _INVELSTKGQK(gl)_
RBM14 Phosphorylation T206 -0.112 -0.221 _QPT(ph)PPFFGR_
RBM14 Phosphorylation S582 0.285 0.247 _TRLS(ph)PPR_
RBM14 Ubiquitylation K593 -0.617 0.778 _ASYDDPYK(gl)K_
RBM14 Phosphorylation S618 1.422 0.845 _RLS(ph)ESQLSFR_
TDG Ubiquitylation K103 0.728 _ITDTFK(gl)VKR_
TDG Ubiquitylation K105 1.500 _ITDTFKVK(gl)_
TDG Ubiquitylation K201 -0.531 0.797 _TTPGSK(gl)DLSSK(gl)EFR_
TDG Ubiquitylation K206 0.334 1.024 _TTPGSK(gl)DLSSK(gl)EFR_
TDG Ubiquitylation K218 1.203 _ILVQK(gl)LQK_
TDG Ubiquitylation K221 1.524 _LQK(gl)YQPR_
TDG Ubiquitylation K246 0.699 1.949 _EVFGVK(gl)VK_
TDG Ubiquitylation K285 1.047 _AQDK(gl)VHYYIK_
TDG Ubiquitylation K293 1.411 _LK(gl)DLRDQLK_
TDG Ubiquitylation K300 0.980 _DQLK(gl)GIER_
THRAP3 Phosphorylation S184 0.079 0.248 _SSS(ph)KDSRPSQAAGDNQGDEAK_
THRAP3 Phosphorylation T210 3.824 _EQTFSGGT(ph)SQDTK_
THRAP3 Phosphorylation S211 3.487 3.148 _EQTFSGGTS(ph)QDTK_
THRAP3 Phosphorylation S232 -0.501 -0.585 _ASESSKPWPDATYGTGS(ph)ASR_
THRAP3 Phosphorylation S243 0.422 0.427 _ASAVSELS(ph)PR_
THRAP3 Phosphorylation S248 0.461 0.278 _ERS(ph)PALKSPLQSVVVR_
THRAP3 Phosphorylation S253 0.721 1.235 _SPALKS(ph)PLQSVVVR_
THRAP3 Phosphorylation S315 0.541 _KS(ph)PVGKS(ph)PPSTGSTYGSSQK_
THRAP3 Phosphorylation S320 -0.234 -0.545 _KSPVGKS(ph)PPSTGSTYGSSQK_
THRAP3 Phosphorylation S377 2.629 2.451 _IKEKGS(ph)FSDTGLGDGK_
THRAP3 Phosphorylation S379 0.975 1.024 _GSFS(ph)DTGLGDGK_
THRAP3 Phosphorylation S575 1.245 0.792 _MDS(ph)FDEDLARPSGLLAQER_
THRAP3 Phosphorylation S672 0.274 0.190 _NKKS(ph)PEIHR_
THRAP3 Phosphorylation S682 0.380 0.508 _IDIS(ph)PSTFR_
THRAP3 Phosphorylation S684 0.619 0.637 _RIDISPS(ph)TFRK_
THRAP3 Phosphorylation T874 -1.185 -1.519 _NREEEWDPEYT(ph)PK_
THRAP3 Phosphorylation S928 0.752 0.713 _WAHDKFS(ph)GEEGEIEDDESGTENR_
THRAP3 Phosphorylation S939 0.345 0.471 _FSGEEGEIEDDES(ph)GTENR_
THRAP3 Phosphorylation T953 -0.085 _FSGEEGEIEDDESGTENREEKDNIQPT(ph)TE_
TP53BP1 Phosphorylation S119 2.253 2.083 _TSS(ph)VLGMSVESAPAVEEEKGEELEQK_
TP53BP1 Phosphorylation S265 0.355 0.274 _SEDM(ox)PFS(ph)PK_
TP53BP1 Phosphorylation S280 -0.705 _EQLS(ph)AQELMESGLQIQKSPEPEVLSTQEDLFDQSNK_
TP53BP1 Phosphorylation S287 -1.294 -1.483 _EQLSAQELMES(ph)GLQIQKSPEPEVLSTQEDLFDQSNK_
TP53BP1 Phosphorylation S294 -1.218 -0.875 _S(ph)PEPEVLSTQEDLFDQSNK_
TP53BP1 Phosphorylation S379 -0.210 _STPFIVPS(ph)SPTEQEGR_
TP53BP1 Phosphorylation S380 -0.036 -0.182 _STPFIVPSS(ph)PTEQEGR_
TP53BP1 Phosphorylation T382 -0.167 _STPFIVPSSPT(ph)EQEGR_
TP53BP1 Phosphorylation S500 0.214 0.591 _NS(ph)PEDLGLSLTGDSCK_
TP53BP1 Phosphorylation S525 -0.547 _LM(ox)LSTSEYSQS(ph)PK_
TP53BP1 Phosphorylation S552 0.102 0.080 _IDEDGENTQIEDTEPMS(ph)PVLNSK_
TP53BP1 Phosphorylation S580 1.645 1.855 _FVPAENDSILMNPAQDGEVQLS(ph)QNDDKTK_
TP53BP1 Phosphorylation S771 0.885 _VDVS(ph)CEPLEGVEK_
TP53BP1 Phosphorylation S831 2.288 2.726 _SGTAETEPVEQDSS(ph)QPSLPLVR_
TP53BP1 Phosphorylation T922 1.634 _EGDIIPPLTGAT(ph)PPLIGHLK_
TP53BP1 Phosphorylation S993 2.280 _LVS(ph)PETEASEESLQFNLEKPATGER_
TP53BP1 Phosphorylation S1028 0.901 0.869 _NGSTAVAESVAS(ph)PQK_
TP53BP1 Phosphorylation T1055 1.132 0.932 _SEDPPT(ph)TPIR_
TP53BP1 Phosphorylation T1056 0.818 0.172 _SEDPPTT(ph)PIR_
TP53BP1 Phosphorylation S1067 3.036 2.786 _GNLLHFPS(ph)SQGEEEKEK_
TP53BP1 Phosphorylation S1068 2.467 3.424 _GNLLHFPSS(ph)QGEEEKEKLEGDHTIR_
TP53BP1 Phosphorylation S1094 -1.038 _QSQQPMKPIS(ph)PVKDPVS(ph)PASQK_
TP53BP1 Phosphorylation S1101 -1.038 _QSQQPMKPIS(ph)PVKDPVS(ph)PASQK_
TP53BP1 Phosphorylation S1113 0.104 0.162 _MVIQGPS(ph)SPQGEAMVTDVLEDQK_
TP53BP1 Phosphorylation S1114 0.438 0.116 _M(ox)VIQGPSS(ph)PQGEAM(ox)VTDVLEDQK_
TP53BP1 Phosphorylation S1317 1.156 1.461 _TSS(ph)GTSLSAMHSSGSSGK_
TP53BP1 Phosphorylation S1362 0.462 0.439 _GGPGKLS(ph)PR_
TP53BP1 Phosphorylation S1426 -0.275 0.340 _ETAVPGPLGIEDIS(ph)PNLSPDDK_
TP53BP1 Phosphorylation S1430 -0.558 -0.362 _ETAVPGPLGIEDISPNLS(ph)PDDK_
TP53BP1 Phosphorylation S1460 -0.626 -0.602 _RS(ph)DSPEIPFQAAAGPSDGLDASSPGNSFVGLR_
TP53BP1 Phosphorylation S1462 -1.029 -0.981 _RSDS(ph)PEIPFQAAAGPSDGLDASSPGNSFVGLR_
TP53BP1 Phosphorylation S1618 -0.090 _AADIS(ph)LDNLVEGK_
TP53BP1 Phosphorylation S1673 -0.238 -0.008 _LITS(ph)EEERS(ph)PAK_
TP53BP1 Phosphorylation S1678 -0.242 -0.396 _LITSEEERS(ph)PAK_
TRERF1 Phosphorylation S540 0.361 -0.011 _AS(ph)PNLKQEEGEK_
TRERF1 Phosphorylation S778 -1.172 -0.181 _SNS(ph)IDGSNVTVTPGPGEQTVDVEPR_
TRERF1 Phosphorylation S782 -0.630 -0.674 _SNSIDGS(ph)NVTVT(ph)PGPGEQTVDVEPR_
TRERF1 Phosphorylation T787 -0.901 -0.736 _SNSIDGS(ph)NVTVT(ph)PGPGEQTVDVEPR_


.

© Copyright Svejstrup Laboratory 2015