bioLOGIC Data » bioLOGIC CategoryView » bioLOGIC VennView » Experimental Details »
bioLOGIC Category

Results for the Category
PTIP-DNA damage response complex
(5197)

RNAi screen result RNAPII IP (MG132) CSB IP CSB IP (MG132) Chrom. Chrom. (MG132) Ubi /Phospo Ubi /Phospho (MG132)
W

Protein Results:

Results for post-translational modifications (below)
Gene name MGoogle Score RNAi high RNAi low RNAPII-IP (MG132) CSB-IP CSB-IP (MG132) Chrom. Chrom. (MG132)
RAD50 3 0.350 -0.420 0.165 0.571 0.509 0.691 0.587
TP53BP1 2 -1.490 1.970 -0.161 -0.160 0.174
TP53BP1 2 -1.490 1.970 0.638 0.558
NBN 2 -0.220 -0.170 0.708 0.569 -0.563 0.354
PAXIP1 1 -1.460 2.910 -0.245 0.364 0.299
MRE11A 0 1.600 -0.730 0.145 0.420
MRE11A 0 1.600 -0.730 0.023 0.453 0.150
BLM 0 1.270 -0.830 -0.850 -0.141 0.144 0.151 0.149
BLM 0 1.270 -0.830

PTM Sites:

Back to Protein Results
Gene name PTM type PTM site UV UV (MG132) Sequence
BLM Phosphorylation S144 1.234 _KLEFSSS(ph)PDSLSTINDWDDMDDFDTSETSK_
MRE11A Ubiquitylation K387 0.442 _FSQK(gl)FVDR_
NBN Phosphorylation T335 -1.121 _T(ph)TTPGPSLSQGVSVDEK_
NBN Phosphorylation S341 3.085 _TTTPGPS(ph)LSQGVSVDEK_
NBN Phosphorylation S343 3.710 3.629 _TTTPGPSLS(ph)QGVSVDEK_
NBN Phosphorylation S397 2.719 1.458 _MLS(ph)QDAPTVK_
NBN Phosphorylation S432 -0.192 -0.395 _IPNYQLS(ph)PTK_
NBN Phosphorylation T434 -0.188 -0.683 _IPNYQLSPT(ph)KLPSINK_
NBN Phosphorylation S615 1.985 4.691 _IS(ph)QENEIGKK_
RAD50 Ubiquitylation K62 -1.069 _YICTGDFPPGTK(gl)GNTFVHDPK_
RAD50 Phosphorylation S635 2.474 3.050 _LFDVCGS(ph)QDFESDLDR_
RAD50 Ubiquitylation K753 0.394 0.397 _NK(gl)LQNVNR_
RAD50 Ubiquitylation K933 0.397 _FQQEKEELINKK(gl)_
RAD50 Ubiquitylation K1068 0.098 _LEENIDNIK(gl)R_
RAD50 Ubiquitylation K1178 -0.548 _SDADENVSASDK(gl)RR_
RAD50 Ubiquitylation K1285 2.195 _SEYVEK(gl)FYR_
TP53BP1 Phosphorylation S119 2.253 2.083 _TSS(ph)VLGMSVESAPAVEEEKGEELEQK_
TP53BP1 Phosphorylation S265 0.355 0.274 _SEDM(ox)PFS(ph)PK_
TP53BP1 Phosphorylation S280 -0.705 _EQLS(ph)AQELMESGLQIQKSPEPEVLSTQEDLFDQSNK_
TP53BP1 Phosphorylation S287 -1.294 -1.483 _EQLSAQELMES(ph)GLQIQKSPEPEVLSTQEDLFDQSNK_
TP53BP1 Phosphorylation S294 -1.218 -0.875 _S(ph)PEPEVLSTQEDLFDQSNK_
TP53BP1 Phosphorylation S379 -0.210 _STPFIVPS(ph)SPTEQEGR_
TP53BP1 Phosphorylation S380 -0.036 -0.182 _STPFIVPSS(ph)PTEQEGR_
TP53BP1 Phosphorylation T382 -0.167 _STPFIVPSSPT(ph)EQEGR_
TP53BP1 Phosphorylation S500 0.214 0.591 _NS(ph)PEDLGLSLTGDSCK_
TP53BP1 Phosphorylation S525 -0.547 _LM(ox)LSTSEYSQS(ph)PK_
TP53BP1 Phosphorylation S552 0.102 0.080 _IDEDGENTQIEDTEPMS(ph)PVLNSK_
TP53BP1 Phosphorylation S580 1.645 1.855 _FVPAENDSILMNPAQDGEVQLS(ph)QNDDKTK_
TP53BP1 Phosphorylation S771 0.885 _VDVS(ph)CEPLEGVEK_
TP53BP1 Phosphorylation S831 2.288 2.726 _SGTAETEPVEQDSS(ph)QPSLPLVR_
TP53BP1 Phosphorylation T922 1.634 _EGDIIPPLTGAT(ph)PPLIGHLK_
TP53BP1 Phosphorylation S993 2.280 _LVS(ph)PETEASEESLQFNLEKPATGER_
TP53BP1 Phosphorylation S1028 0.901 0.869 _NGSTAVAESVAS(ph)PQK_
TP53BP1 Phosphorylation T1055 1.132 0.932 _SEDPPT(ph)TPIR_
TP53BP1 Phosphorylation T1056 0.818 0.172 _SEDPPTT(ph)PIR_
TP53BP1 Phosphorylation S1067 3.036 2.786 _GNLLHFPS(ph)SQGEEEKEK_
TP53BP1 Phosphorylation S1068 2.467 3.424 _GNLLHFPSS(ph)QGEEEKEKLEGDHTIR_
TP53BP1 Phosphorylation S1094 -1.038 _QSQQPMKPIS(ph)PVKDPVS(ph)PASQK_
TP53BP1 Phosphorylation S1101 -1.038 _QSQQPMKPIS(ph)PVKDPVS(ph)PASQK_
TP53BP1 Phosphorylation S1113 0.104 0.162 _MVIQGPS(ph)SPQGEAMVTDVLEDQK_
TP53BP1 Phosphorylation S1114 0.438 0.116 _M(ox)VIQGPSS(ph)PQGEAM(ox)VTDVLEDQK_
TP53BP1 Phosphorylation S1317 1.156 1.461 _TSS(ph)GTSLSAMHSSGSSGK_
TP53BP1 Phosphorylation S1362 0.462 0.439 _GGPGKLS(ph)PR_
TP53BP1 Phosphorylation S1426 -0.275 0.340 _ETAVPGPLGIEDIS(ph)PNLSPDDK_
TP53BP1 Phosphorylation S1430 -0.558 -0.362 _ETAVPGPLGIEDISPNLS(ph)PDDK_
TP53BP1 Phosphorylation S1460 -0.626 -0.602 _RS(ph)DSPEIPFQAAAGPSDGLDASSPGNSFVGLR_
TP53BP1 Phosphorylation S1462 -1.029 -0.981 _RSDS(ph)PEIPFQAAAGPSDGLDASSPGNSFVGLR_
TP53BP1 Phosphorylation S1618 -0.090 _AADIS(ph)LDNLVEGK_
TP53BP1 Phosphorylation S1673 -0.238 -0.008 _LITS(ph)EEERS(ph)PAK_
TP53BP1 Phosphorylation S1678 -0.242 -0.396 _LITSEEERS(ph)PAK_


© Copyright Svejstrup Laboratory 2015