bioLOGIC Data » bioLOGIC CategoryView » bioLOGIC VennView » Experimental Details »

bioLOGIC Category

Results for the Category
replication fork
(GO:0005657)

RNAi screen result RNAPII IP (MG132) CSB IP CSB IP (MG132) Chrom. Chrom. (MG132) Ubi /Phospo Ubi /Phospho (MG132)
W

Protein Results:

 Results for post-translational modifications (below)
Gene name MGoogle Score RNAi high RNAi low RNAPII-IP (MG132) CSB-IP CSB-IP (MG132) Chrom. Chrom. (MG132)
TP53BP1 2 -1.490 1.970 -0.161 -0.160 0.174
TP53BP1 2 -1.490 1.970 0.638 0.558
RAD18 2 0.290 -0.170
RAD18 2 0.290 -0.170 0.133 -0.034 0.651
RAD18 2 0.290 -0.170 -0.119
NBN 2 -0.220 -0.170 0.708 0.569 -0.563 0.354
DNMT1 2 0.150 -0.150 0.077 -0.109 -1.422 0.572
DNMT1 2 0.150 -0.150 0.134 -0.347 -0.054
CHEK1 2 -1.170 1.560
CHEK1 2 -1.170 1.560
H2AFX 2 -0.474 -0.395 0.182 0.824 0.499
H2AFX 2
HDAC2 1 -2.390 4.970
HDAC2 1 -2.390 4.970 0.187 -0.007 0.825
TP53 0 -1.070 1.050 -2.808 0.076 -0.094 0.436 0.497
DMAP1 0 0.140 -0.320 -0.406 -0.073 0.671 -0.198 0.239
BLM 0 1.270 -0.830 -0.850 -0.141 0.144 0.151 0.149
BLM 0 1.270 -0.830

PTM Sites:

 Back to Protein Results
Gene name PTM type PTM site UV UV (MG132) Sequence
BLM Phosphorylation S144 1.234 _KLEFSSS(ph)PDSLSTINDWDDMDDFDTSETSK_
CHEK1 Ubiquitylation K53 0.879 _AVDCPENIK(gl)K_
CHEK1 Ubiquitylation K54 0.738 _AVDCPENIKK(gl)_
CHEK1 Phosphorylation S296 -0.098 0.184 _VTS(ph)GGVSESPSGFSK_
CHEK1 Phosphorylation S300 1.091 _VTSGGVS(ph)ESPSGFSK_
CHEK1 Phosphorylation S302 1.750 _VTSGGVSES(ph)PSGFSK_
CHEK1 Phosphorylation S317 1.903 _HIQSNLDFS(ph)PVNSASSEENVK_
CHEK1 Ubiquitylation K399 -0.582 _ETCEK(gl)LGYQWK_
DMAP1 Ubiquitylation K192 -0.293 _SVEDLK(gl)ER_
DMAP1 Phosphorylation T445 -0.299 -0.664 _DTIIDVVGAPLT(ph)PNSR_
DNMT1 Phosphorylation S127 -0.755 -0.836 _VGM(ox)ADANS(ph)PPKPLSKPR_
DNMT1 Phosphorylation S143 0.877 0.220 _SKS(ph)DGEAKPEPSPSPR_
DNMT1 Phosphorylation S152 -0.685 -1.347 _SDGEAKPEPS(ph)PSPR_
DNMT1 Phosphorylation S154 -1.926 -0.876 _SDGEAKPEPSPS(ph)PR_
DNMT1 Ubiquitylation K586 1.686 3.368 _DLIK(gl)LAGVTLGQR_
DNMT1 Ubiquitylation K675 1.267 0.915 _DMVK(gl)FGGSGR_
DNMT1 Phosphorylation S714 -0.773 -0.554 _EADDDEEVDDNIPEMPS(ph)PKK_
DNMT1 Phosphorylation S954 -0.318 0.057 _LSS(ph)PVKRPR_
DNMT1 Ubiquitylation K961 -3.166 _K(gl)EPVDEDLYPEHYR_
DNMT1 Ubiquitylation K981 -0.298 -1.482 _YSDYIK(gl)GSNLDAPEPYR_
DNMT1 Ubiquitylation K997 0.042 0.154 _IK(gl)EIFCPK_
DNMT1 Ubiquitylation K1483 1.983 -0.103 _GVCSCVEAGK(gl)ACDPAAR_
H2AFX Ubiquitylation K116 -0.071 _ATIAGGGVIPHIHK(gl)SLIGK_
H2AFX Ubiquitylation K120 0.702 0.181 _K(gl)TSATVGPK_
H2AFX Ubiquitylation K121 1.548 0.818 _SLIGK(gl)K(gl)GQQK_
H2AFX Ubiquitylation K122 1.238 -0.400 _SLIGK(gl)K(gl)GQQK_
H2AFX Ubiquitylation K126 1.132 _KGQQK(gl)TV_
H2AFX Ubiquitylation K128 -0.411 0.117 _KTSATVGPK(gl)APSGGKK_
H2AFX Phosphorylation S140 1.817 1.205 _KATQAS(ph)QEY_
HDAC2 Ubiquitylation K50 0.036 _K(gl)MEIYRPHK_
HDAC2 Ubiquitylation K67 -0.467 _ATAEEMTK(gl)YHSDEYIK_
HDAC2 Ubiquitylation K89 0.749 -0.241 _SIRPDNMSEYSK(gl)QMQR_
HDAC2 Ubiquitylation K284 0.749 _GHAK(gl)CVEVVK_
HDAC2 Phosphorylation S394 -0.865 -0.997 _M(ox)LPHAPGVQM(ox)QAIPEDAVHEDS(ph)GDEDGEDPDKR_
HDAC2 Phosphorylation S422 0.482 0.781 _IACDEEFS(ph)DSEDEGEGGR_
NBN Phosphorylation T335 -1.121 _T(ph)TTPGPSLSQGVSVDEK_
NBN Phosphorylation S341 3.085 _TTTPGPS(ph)LSQGVSVDEK_
NBN Phosphorylation S343 3.710 3.629 _TTTPGPSLS(ph)QGVSVDEK_
NBN Phosphorylation S397 2.719 1.458 _MLS(ph)QDAPTVK_
NBN Phosphorylation S432 -0.192 -0.395 _IPNYQLS(ph)PTK_
NBN Phosphorylation T434 -0.188 -0.683 _IPNYQLSPT(ph)KLPSINK_
NBN Phosphorylation S615 1.985 4.691 _IS(ph)QENEIGKK_
RAD18 Ubiquitylation K13 0.971 -0.795 _TVTITK(gl)EDESTEK_
RAD18 Ubiquitylation K73 -1.744 _TQCPTCCVTVTEPDLK(gl)NNR_
RAD18 Phosphorylation S99 -0.633 0.106 _NHLLQFALES(ph)PAK_
RAD18 Phosphorylation S103 1.453 1.119 _NHLLQFALESPAKS(ph)PASSSSK_
RAD18 Ubiquitylation K110 -0.405 -0.669 _SPASSSSK(gl)NLAVK_
RAD18 Ubiquitylation K110 -0.405 -0.669 _SPASSSSK(gl)NLAVK_
RAD18 Ubiquitylation K115 -0.231 -0.368 _NLAVK(gl)VYTPVASR_
RAD18 Ubiquitylation K151 0.809 0.351 _EMSGSTSELLIK(gl)ENK_
RAD18 Ubiquitylation K154 0.097 0.713 _EMSGSTSELLIKENK(gl)SK_
RAD18 Ubiquitylation K156 0.757 0.161 _SK(gl)FSPQK_
RAD18 Ubiquitylation K161 -0.335 -0.403 _FSPQK(gl)EASPAAK_
RAD18 Ubiquitylation K186 -1.903 -2.009 _SVEEIAPDPSEAK(gl)RPEPPSTSTLK_
RAD18 Ubiquitylation K197 -1.182 _RPEPPSTSTLK(gl)QVTK_
RAD18 Ubiquitylation K258 -0.742 _TVYNLLSDRDLKK(gl)_
RAD18 Ubiquitylation K261 0.601 0.053 _LK(gl)EHGLSIQGNK_
RAD18 Ubiquitylation K309 0.251 _SAAEIVQEIENIEK(gl)TR_
RAD18 Ubiquitylation K318 1.786 _LEASK(gl)LNESVMVFTK_
RAD18 Ubiquitylation K333 0.989 1.516 _DQTEK(gl)EIDEIHSK_
RAD18 Ubiquitylation K370 -0.695 _IAGMSQK(gl)TVTITK_
RAD18 Ubiquitylation K376 0.971 -0.795 _TVTITK(gl)EDESTEK_
RAD18 Phosphorylation S471 0.270 0.272 _NDLQDTEIS(ph)PR_
TP53 Ubiquitylation K120 -0.188 _LGFLHSGTAK(gl)SVTCTYSPALNK_
TP53 Ubiquitylation K164 0.157 -1.260 _AMAIYK(gl)QSQHMTEVVR_
TP53 Phosphorylation S314 -0.695 -1.000 _ALPNNTSS(ph)SPQPK_
TP53 Phosphorylation S315 -0.762 -0.959 _RALPNNTSSS(ph)PQPK_
TP53 Ubiquitylation K320 -0.978 _ALPNNTSSSPQPKK(gl)_
TP53 Ubiquitylation K357 -0.231 -0.823 _ELNEALELKDAQAGK(gl)EPGGSR_
TP53BP1 Phosphorylation S119 2.253 2.083 _TSS(ph)VLGMSVESAPAVEEEKGEELEQK_
TP53BP1 Phosphorylation S265 0.355 0.274 _SEDM(ox)PFS(ph)PK_
TP53BP1 Phosphorylation S280 -0.705 _EQLS(ph)AQELMESGLQIQKSPEPEVLSTQEDLFDQSNK_
TP53BP1 Phosphorylation S287 -1.294 -1.483 _EQLSAQELMES(ph)GLQIQKSPEPEVLSTQEDLFDQSNK_
TP53BP1 Phosphorylation S294 -1.218 -0.875 _S(ph)PEPEVLSTQEDLFDQSNK_
TP53BP1 Phosphorylation S379 -0.210 _STPFIVPS(ph)SPTEQEGR_
TP53BP1 Phosphorylation S380 -0.036 -0.182 _STPFIVPSS(ph)PTEQEGR_
TP53BP1 Phosphorylation T382 -0.167 _STPFIVPSSPT(ph)EQEGR_
TP53BP1 Phosphorylation S500 0.214 0.591 _NS(ph)PEDLGLSLTGDSCK_
TP53BP1 Phosphorylation S525 -0.547 _LM(ox)LSTSEYSQS(ph)PK_
TP53BP1 Phosphorylation S552 0.102 0.080 _IDEDGENTQIEDTEPMS(ph)PVLNSK_
TP53BP1 Phosphorylation S580 1.645 1.855 _FVPAENDSILMNPAQDGEVQLS(ph)QNDDKTK_
TP53BP1 Phosphorylation S771 0.885 _VDVS(ph)CEPLEGVEK_
TP53BP1 Phosphorylation S831 2.288 2.726 _SGTAETEPVEQDSS(ph)QPSLPLVR_
TP53BP1 Phosphorylation T922 1.634 _EGDIIPPLTGAT(ph)PPLIGHLK_
TP53BP1 Phosphorylation S993 2.280 _LVS(ph)PETEASEESLQFNLEKPATGER_
TP53BP1 Phosphorylation S1028 0.901 0.869 _NGSTAVAESVAS(ph)PQK_
TP53BP1 Phosphorylation T1055 1.132 0.932 _SEDPPT(ph)TPIR_
TP53BP1 Phosphorylation T1056 0.818 0.172 _SEDPPTT(ph)PIR_
TP53BP1 Phosphorylation S1067 3.036 2.786 _GNLLHFPS(ph)SQGEEEKEK_
TP53BP1 Phosphorylation S1068 2.467 3.424 _GNLLHFPSS(ph)QGEEEKEKLEGDHTIR_
TP53BP1 Phosphorylation S1094 -1.038 _QSQQPMKPIS(ph)PVKDPVS(ph)PASQK_
TP53BP1 Phosphorylation S1101 -1.038 _QSQQPMKPIS(ph)PVKDPVS(ph)PASQK_
TP53BP1 Phosphorylation S1113 0.104 0.162 _MVIQGPS(ph)SPQGEAMVTDVLEDQK_
TP53BP1 Phosphorylation S1114 0.438 0.116 _M(ox)VIQGPSS(ph)PQGEAM(ox)VTDVLEDQK_
TP53BP1 Phosphorylation S1317 1.156 1.461 _TSS(ph)GTSLSAMHSSGSSGK_
TP53BP1 Phosphorylation S1362 0.462 0.439 _GGPGKLS(ph)PR_
TP53BP1 Phosphorylation S1426 -0.275 0.340 _ETAVPGPLGIEDIS(ph)PNLSPDDK_
TP53BP1 Phosphorylation S1430 -0.558 -0.362 _ETAVPGPLGIEDISPNLS(ph)PDDK_
TP53BP1 Phosphorylation S1460 -0.626 -0.602 _RS(ph)DSPEIPFQAAAGPSDGLDASSPGNSFVGLR_
TP53BP1 Phosphorylation S1462 -1.029 -0.981 _RSDS(ph)PEIPFQAAAGPSDGLDASSPGNSFVGLR_
TP53BP1 Phosphorylation S1618 -0.090 _AADIS(ph)LDNLVEGK_
TP53BP1 Phosphorylation S1673 -0.238 -0.008 _LITS(ph)EEERS(ph)PAK_
TP53BP1 Phosphorylation S1678 -0.242 -0.396 _LITSEEERS(ph)PAK_


.

© Copyright Svejstrup Laboratory 2015