bioLOGIC Data » bioLOGIC CategoryView » bioLOGIC VennView » Experimental Details »
bioLOGIC Category

Results for the Category
BRCT_dom
(IPR001357)

RNAi screen result RNAPII IP (MG132) CSB IP CSB IP (MG132) Chrom. Chrom. (MG132) Ubi /Phospo Ubi /Phospho (MG132)
W

Protein Results:

Results for post-translational modifications (below)
Gene name MGoogle Score RNAi high RNAi low RNAPII-IP (MG132) CSB-IP CSB-IP (MG132) Chrom. Chrom. (MG132)
RFC1 3 2.530 -1.230 0.635 1.060 1.028 0.826
TOPBP1 3 -2.480 4.260 -0.269 0.277
BRCA1 2 0.200 -0.140 0.433 0.018 0.146
TP53BP1 2 -1.490 1.970 -0.161 -0.160 0.174
TP53BP1 2 -1.490 1.970 0.638 0.558
NBN 2 -0.220 -0.170 0.708 0.569 -0.563 0.354
PARP1 2
PARP1 2 -0.200 0.357 0.412 0.442 0.293
LIG3 1 -0.380 2.090 -0.284 0.336 0.549 0.370
PAXIP1 1 -1.460 2.910 -0.245 0.364 0.299
TERF2IP 1 0.500 -0.780 -0.491 1.304 2.217 -1.505 -0.760
TERF2IP 1 1.450 -1.010 -0.491 1.304 2.217 -1.505 -0.760
TERF2IP 1 1.580 -0.650 -0.491 1.304 2.217 -1.505 -0.760
DBF4 0 -0.280 -0.140
XRCC1 0 -0.010 0.060 -0.364 -0.736 -0.059 0.224 0.061
PES1 0 0.000 0.210 -1.535 -0.358
ECT2 0 0.620 -0.960 -0.787
POLM 0 -0.250 1.450
BARD1 0 0.470 0.260
SMARCC2 0 -0.770 0.630
SMARCC2 0 -0.770 0.630 0.151 0.139 0.622 0.709 0.505
MCPH1 0 -0.270 -0.170
SMARCC1 0 0.140 0.090 0.553 0.112 0.584 0.137 0.136

PTM Sites:

Back to Protein Results
Gene name PTM type PTM site UV UV (MG132) Sequence
BARD1 Phosphorylation S186 0.193 0.942 _DASAQQDSYEFVSPS(ph)PPADVSER_
BRCA1 Phosphorylation S123 0.465 0.445 _KENNSPEHLKDEVS(ph)IIQSM(ox)GYR_
BRCA1 Phosphorylation S753 2.662 4.077 _VSNNAEDPKDLMLS(ph)GER_
BRCA1 Phosphorylation S1009 0.733 1.028 _KNLLEENFEEHSM(ox)S(ph)PER_
BRCA1 Phosphorylation S1546 1.821 2.105 _NYPS(ph)QEELIK_
BRCA1 Phosphorylation S1564 3.065 _VVDVEEQQLEES(ph)GPHDLTETSYLPR_
BRCA1 Phosphorylation S1664 1.120 _EKPELTAS(ph)TER_
DBF4 Phosphorylation S359 -0.054 -0.470 _YSVGSLS(ph)PVSASVLK_
LIG3 Phosphorylation T209 -0.306 -0.552 _LTTTGQVT(ph)SPVK_
LIG3 Phosphorylation S210 -0.163 0.011 _LTTTGQVTS(ph)PVK_
LIG3 Phosphorylation S241 -0.868 -0.902 _PNNSGEAPS(ph)SPTPK_
LIG3 Phosphorylation S242 -0.782 -0.612 _FSGFSAKPNNSGEAPSS(ph)PTPK_
LIG3 Ubiquitylation K728 0.493 0.853 _WCTVTK(gl)CAGGHDDATLAR_
LIG3 Ubiquitylation K833 1.857 0.467 _ELYQLSK(gl)EK_
MCPH1 Phosphorylation S333 -0.272 0.038 _YRLS(ph)PTLSSTK_
MCPH1 Phosphorylation T335 -0.306 _YRLSPT(ph)LSSTK_
NBN Phosphorylation T335 -1.121 _T(ph)TTPGPSLSQGVSVDEK_
NBN Phosphorylation S341 3.085 _TTTPGPS(ph)LSQGVSVDEK_
NBN Phosphorylation S343 3.710 3.629 _TTTPGPSLS(ph)QGVSVDEK_
NBN Phosphorylation S397 2.719 1.458 _MLS(ph)QDAPTVK_
NBN Phosphorylation S432 -0.192 -0.395 _IPNYQLS(ph)PTK_
NBN Phosphorylation T434 -0.188 -0.683 _IPNYQLSPT(ph)KLPSINK_
NBN Phosphorylation S615 1.985 4.691 _IS(ph)QENEIGKK_
PARP1 Phosphorylation S41 -0.803 _MAIMVQS(ph)PMFDGK_
PARP1 Ubiquitylation K84 1.223 _WDDQQK(gl)VK_
PARP1 Ubiquitylation K86 1.058 _VK(gl)KTAEAGGVTGK_
PARP1 Ubiquitylation K87 1.058 _VK(gl)KTAEAGGVTGK_
PARP1 Ubiquitylation K97 1.386 0.406 _TAEAGGVTGK(gl)GQDGIGSK_
PARP1 Ubiquitylation K105 0.828 _GQDGIGSK(gl)AEK_
PARP1 Ubiquitylation K108 1.317 _GQDGIGSKAEK(gl)_
PARP1 Ubiquitylation K119 1.569 _TLGDFAAEYAK(gl)SNR_
PARP1 Ubiquitylation K131 1.025 1.620 _GCMEK(gl)IEK_
PARP1 Ubiquitylation K197 0.445 1.157 _K(gl)QLPGVK_
PARP1 Ubiquitylation K254 0.589 _AQNDLIWNIKDELKK(gl)_
PARP1 Ubiquitylation K262 0.456 _VCSTNDLK(gl)ELLIFNK_
PARP1 Ubiquitylation K320 1.464 1.034 _SDAYYCTGDVTAWTK(gl)CMVK_
PARP1 Ubiquitylation K331 -0.425 -0.480 _TQTPNRK(gl)EWVTPK_
PARP1 Ubiquitylation K337 0.462 0.332 _EWVTPK(gl)EFR_
PARP1 Ubiquitylation K346 0.370 0.411 _EISYLK(gl)K_
PARP1 Phosphorylation T368 -1.474 -1.410 _IFPPETSASVAAT(ph)PPPSTASAPAAVNSSASADKPLSNM(ox)K_
PARP1 Ubiquitylation K400 0.844 1.095 _ILTLGK(gl)LSR_
PARP1 Ubiquitylation K414 1.227 1.241 _AMIEK(gl)LGGK_
PARP1 Ubiquitylation K418 1.131 _LGGK(gl)LTGTANK_
PARP1 Ubiquitylation K425 0.912 0.815 _LTGTANK(gl)ASLCISTKK_
PARP1 Ubiquitylation K433 0.942 _ASLCISTK(gl)K_
PARP1 Ubiquitylation K434 0.020 _ASLCISTKK(gl)_
PARP1 Ubiquitylation K447 1.480 _MEEVK(gl)EANIR_
PARP1 Ubiquitylation K518 0.108 _GQVKEEGINK(gl)SEK_
PARP1 Ubiquitylation K521 0.630 _GQVKEEGINKSEK(gl)R_
PARP1 Ubiquitylation K548 0.125 -0.480 _GGAAVDPDSGLEHSAHVLEK(gl)GGK_
PARP1 Ubiquitylation K551 0.492 -0.573 _GGAAVDPDSGLEHSAHVLEKGGK(gl)_
PARP1 Ubiquitylation K629 1.632 _TGNAWHSK(gl)NFTK_
PARP1 Ubiquitylation K633 0.964 0.091 _NFTK(gl)YPK_
PARP1 Ubiquitylation K654 -0.086 _K(gl)LTVNPGTK_
PARP1 Ubiquitylation K662 0.112 _LTVNPGTK(gl)SK_
PARP1 Ubiquitylation K664 -0.042 -0.111 _LTVNPGTKSK(gl)_
PARP1 Ubiquitylation K683 0.983 1.355 _MIFDVESM(ox)K(gl)K_
PARP1 Ubiquitylation K684 1.213 1.355 _MIFDVESMKK(gl)_
PARP1 Ubiquitylation K700 0.448 _MPLGK(gl)LSK_
PARP1 Phosphorylation S782 0.648 0.490 _GGS(ph)DDSSKDPIDVNYEK_
PARP1 Ubiquitylation K949 0.738 _HSVK(gl)GLGK_
PES1 Ubiquitylation K98 -0.002 _AYGK(gl)SEWNTVER_
PES1 Ubiquitylation K533 0.504 1.270 _LAQEEESEAK(gl)R_
POLM Phosphorylation S12 -0.628 -0.519 _VGS(ph)PSGDAASSTPPSTR_
RFC1 Phosphorylation S156 -0.050 0.188 _NKPLS(ph)PIK_
RFC1 Phosphorylation T161 2.131 1.586 _NKPLS(ph)PIKLT(ph)PTSVLDYFGTGSVQR_
RFC1 Phosphorylation T163 1.551 _NKPLS(ph)PIKLTPT(ph)SVLDYFGTGSVQR_
RFC1 Phosphorylation S190 2.756 2.241 _ELS(ph)QNTDESGLNDEAIAK_
RFC1 Ubiquitylation K240 0.991 _TLAMLDEEPKTKK(gl)_
RFC1 Ubiquitylation K271 0.551 _VK(gl)TAQVSDERK_
RFC1 Phosphorylation S368 0.431 0.440 _KESVS(ph)PEDSEK_
RFC1 Ubiquitylation K436 -0.227 _YGGK(gl)VTGNVSK_
RFC1 Ubiquitylation K498 0.781 _SKYEIAVETEMK(gl)K_
RFC1 Ubiquitylation K499 0.781 _SKYEIAVETEMK(gl)K_
SMARCC1 Phosphorylation S310 -0.047 0.123 _NEEPVRS(ph)PERR_
SMARCC1 Phosphorylation S328 -0.755 -0.358 _KHS(ph)PS(ph)PPPPTPTESR_
SMARCC1 Phosphorylation S330 -0.755 -1.491 _KHS(ph)PS(ph)PPPPTPTESR_
SMARCC1 Ubiquitylation K588 -0.831 _SPQVPAAQQMLNFPEK(gl)NK_
SMARCC1 Ubiquitylation K590 -0.737 _NK(gl)EKPVDLQNFGLR_
SMARCC1 Ubiquitylation K592 -0.509 _EK(gl)PVDLQNFGLR_
SMARCC1 Ubiquitylation K608 -0.342 0.588 _TDIYSK(gl)K_
SMARCC1 Ubiquitylation K609 -0.053 0.520 _TDIYSKK(gl)_
SMARCC1 Ubiquitylation K716 0.001 _VASAAAK(gl)AALEEFSR_
SMARCC1 Ubiquitylation K882 0.402 _AK(gl)HLAAVEER_
SMARCC2 Ubiquitylation K161 -0.199 _LKDIIK(gl)R_
SMARCC2 Phosphorylation S283 0.602 0.869 _TLTDEVNS(ph)PDSDRR_
SMARCC2 Phosphorylation S302 -0.755 -0.668 _RS(ph)PSPSPTPEAK_
SMARCC2 Phosphorylation S347 -0.627 -0.862 _DMDEPS(ph)PVPNVEEVTLPK_
SMARCC2 Ubiquitylation K455 -0.775 _ALPEFFNGKNK(gl)_
SMARCC2 Ubiquitylation K694 0.389 _VASAAAK(gl)SALEEFSK_
SMARCC2 Ubiquitylation K872 -0.712 _DIGEGNLSTAAAAALAAAAVK(gl)AK_
SMARCC2 Ubiquitylation K874 0.402 _AK(gl)HLAAVEER_
SMARCC2 Ubiquitylation K902 0.641 0.460 _KLEIK(gl)LR_
TERF2IP Phosphorylation S36 0.199 -0.039 _DDGSSMSFYVRPS(ph)PAK_
TERF2IP Phosphorylation S154 0.255 -0.049 _S(ph)PSSVTGNALWK_
TERF2IP Phosphorylation S156 0.369 0.179 _ENARSPS(ph)SVTGNALWK_
TERF2IP Phosphorylation S157 0.410 _ENARSPSS(ph)VTGNALWK_
TERF2IP Phosphorylation S203 -0.351 -0.260 _YLLGDAPVS(ph)PSSQK_
TERF2IP Ubiquitylation K228 -0.229 _KAEEDPEAADSGEPQNK(gl)R_
TOPBP1 Ubiquitylation K789 -0.950 _FQSK(gl)AFR_
TOPBP1 Phosphorylation S888 2.918 1.917 _NAVALSAS(ph)PQLK_
TP53BP1 Phosphorylation S119 2.253 2.083 _TSS(ph)VLGMSVESAPAVEEEKGEELEQK_
TP53BP1 Phosphorylation S265 0.355 0.274 _SEDM(ox)PFS(ph)PK_
TP53BP1 Phosphorylation S280 -0.705 _EQLS(ph)AQELMESGLQIQKSPEPEVLSTQEDLFDQSNK_
TP53BP1 Phosphorylation S287 -1.294 -1.483 _EQLSAQELMES(ph)GLQIQKSPEPEVLSTQEDLFDQSNK_
TP53BP1 Phosphorylation S294 -1.218 -0.875 _S(ph)PEPEVLSTQEDLFDQSNK_
TP53BP1 Phosphorylation S379 -0.210 _STPFIVPS(ph)SPTEQEGR_
TP53BP1 Phosphorylation S380 -0.036 -0.182 _STPFIVPSS(ph)PTEQEGR_
TP53BP1 Phosphorylation T382 -0.167 _STPFIVPSSPT(ph)EQEGR_
TP53BP1 Phosphorylation S500 0.214 0.591 _NS(ph)PEDLGLSLTGDSCK_
TP53BP1 Phosphorylation S525 -0.547 _LM(ox)LSTSEYSQS(ph)PK_
TP53BP1 Phosphorylation S552 0.102 0.080 _IDEDGENTQIEDTEPMS(ph)PVLNSK_
TP53BP1 Phosphorylation S580 1.645 1.855 _FVPAENDSILMNPAQDGEVQLS(ph)QNDDKTK_
TP53BP1 Phosphorylation S771 0.885 _VDVS(ph)CEPLEGVEK_
TP53BP1 Phosphorylation S831 2.288 2.726 _SGTAETEPVEQDSS(ph)QPSLPLVR_
TP53BP1 Phosphorylation T922 1.634 _EGDIIPPLTGAT(ph)PPLIGHLK_
TP53BP1 Phosphorylation S993 2.280 _LVS(ph)PETEASEESLQFNLEKPATGER_
TP53BP1 Phosphorylation S1028 0.901 0.869 _NGSTAVAESVAS(ph)PQK_
TP53BP1 Phosphorylation T1055 1.132 0.932 _SEDPPT(ph)TPIR_
TP53BP1 Phosphorylation T1056 0.818 0.172 _SEDPPTT(ph)PIR_
TP53BP1 Phosphorylation S1067 3.036 2.786 _GNLLHFPS(ph)SQGEEEKEK_
TP53BP1 Phosphorylation S1068 2.467 3.424 _GNLLHFPSS(ph)QGEEEKEKLEGDHTIR_
TP53BP1 Phosphorylation S1094 -1.038 _QSQQPMKPIS(ph)PVKDPVS(ph)PASQK_
TP53BP1 Phosphorylation S1101 -1.038 _QSQQPMKPIS(ph)PVKDPVS(ph)PASQK_
TP53BP1 Phosphorylation S1113 0.104 0.162 _MVIQGPS(ph)SPQGEAMVTDVLEDQK_
TP53BP1 Phosphorylation S1114 0.438 0.116 _M(ox)VIQGPSS(ph)PQGEAM(ox)VTDVLEDQK_
TP53BP1 Phosphorylation S1317 1.156 1.461 _TSS(ph)GTSLSAMHSSGSSGK_
TP53BP1 Phosphorylation S1362 0.462 0.439 _GGPGKLS(ph)PR_
TP53BP1 Phosphorylation S1426 -0.275 0.340 _ETAVPGPLGIEDIS(ph)PNLSPDDK_
TP53BP1 Phosphorylation S1430 -0.558 -0.362 _ETAVPGPLGIEDISPNLS(ph)PDDK_
TP53BP1 Phosphorylation S1460 -0.626 -0.602 _RS(ph)DSPEIPFQAAAGPSDGLDASSPGNSFVGLR_
TP53BP1 Phosphorylation S1462 -1.029 -0.981 _RSDS(ph)PEIPFQAAAGPSDGLDASSPGNSFVGLR_
TP53BP1 Phosphorylation S1618 -0.090 _AADIS(ph)LDNLVEGK_
TP53BP1 Phosphorylation S1673 -0.238 -0.008 _LITS(ph)EEERS(ph)PAK_
TP53BP1 Phosphorylation S1678 -0.242 -0.396 _LITSEEERS(ph)PAK_
XRCC1 Ubiquitylation K143 0.287 0.218 _VK(gl)IVCSQPYSK_
XRCC1 Ubiquitylation K183 0.349 _VTVTK(gl)LGQFR_
XRCC1 Phosphorylation S240 -1.676 _TSPVTASDPAGPSYAAATLQASSAASSAS(ph)PVSR_
XRCC1 Phosphorylation T249 -0.792 -0.550 _AIGST(ph)SKPQESPKGK_
XRCC1 Phosphorylation S255 -1.174 -0.626 _AIGSTSKPQES(ph)PK_
XRCC1 Phosphorylation S280 0.316 0.913 _KTPSKPPAQLS(ph)PSVPK_
XRCC1 Phosphorylation S282 0.731 _KTPSKPPAQLS(ph)PSVPK_
XRCC1 Ubiquitylation K355 0.580 _DK(gl)ALELGAK_
XRCC1 Phosphorylation S460 -1.302 -0.863 _TKPTQAAGPS(ph)SPQKPPT(ph)PEETK_
XRCC1 Phosphorylation S461 -2.007 -4.025 _TKPTQAAGPSS(ph)PQKPPTPEETK_
XRCC1 Phosphorylation T467 -1.175 -1.061 _TKPTQAAGPSS(ph)PQKPPT(ph)PEETK_
XRCC1 Phosphorylation T471 -1.661 _TKPTQAAGPSS(ph)PQKPPT(ph)PEETK_
XRCC1 Phosphorylation S475 -0.043 0.033 _AAS(ph)PVLQEDIDIEGVQSEGQDNGAEDSGDTEDELRR_


© Copyright Svejstrup Laboratory 2015