bioLOGIC Data » bioLOGIC CategoryView » bioLOGIC VennView » Experimental Details »

bioLOGIC Category

Results for the Category
methylated histone residue binding
(GO:0035064)

RNAi screen result RNAPII IP (MG132) CSB IP CSB IP (MG132) Chrom. Chrom. (MG132) Ubi /Phospo Ubi /Phospho (MG132)
W

Protein Results:

 Results for post-translational modifications (below)
Gene name MGoogle Score RNAi high RNAi low RNAPII-IP (MG132) CSB-IP CSB-IP (MG132) Chrom. Chrom. (MG132)
TP53BP1 2 -1.490 1.970 -0.161 -0.160 0.174
TP53BP1 2 -1.490 1.970 0.638 0.558
MSH6 2 -0.410 0.140 -0.115 0.232 0.645 0.407 0.101
L3MBTL2 1 0.230 0.100 -0.842 -0.492 0.272
CHD8 1 -1.310 2.760 -0.896 0.435 0.478 -1.819 -1.191
CHD8 1 -1.310 2.760 -1.168 0.026 0.297
LRWD1 1 0.490 -0.390 -0.233 0.037 0.364 0.157 0.333
MPHOSPH8 1 0.330 -0.220 0.872 1.388 0.373
MSL3 0
KDM4A 0 1.040 -0.260 -0.576
ING3 0 1.060 -0.840
TDRD3 0 -1.210 1.400 0.288 1.145
CBX5 0 0.350 -0.490 0.332 -0.485 0.744 0.961 0.512
KAT8 0 -0.610 0.360
SPIN1 0 -0.020 0.710 -0.469 -0.250 0.311 0.101 0.078
ING4 0 -0.510 0.730
PHF13 0 0.540 -0.820
RBBP5 0 -0.150 -0.170 0.443 0.219 0.902 0.167 0.464
RRP8 0 0.000 0.030 -0.172 0.390
GLYR1 0 0.440 -0.680 0.569 0.271
GLYR1 0 0.440 -0.680 0.644 0.325
CBX4 0 0.230 0.160 0.798 0.323
MTF2 0 1.093 0.072
NCAPG2 0 -0.370 0.160 0.221 0.003
NCAPD3 0 -0.210 -0.080 0.119 -0.774 -0.255
CDYL 0 -1.020 2.440 -1.146 0.317 0.535 0.477
CHD1 0 -0.860 0.880 -0.551 0.633 0.179 0.182
CDY1 0 -1.150 2.090 -1.146 0.317 0.535 0.477
CDY1 0 -0.980 1.090 -1.146 0.317 0.535 0.477
CDY1 0 -0.790 0.700 -1.146 0.317 0.535 0.477
CDY1 0 0.360 -0.430 -1.146 0.317 0.535 0.477
CDY1B 0 -1.146 0.317 0.535 0.477
CCDC101 0 -0.330 -0.120 0.120
SUZ12 0 -0.710 0.770 0.451 1.156
SUZ12 0 -0.710 0.770 -0.670 0.955 0.457
PHF2 0 -0.170 0.470 0.652 0.449

PTM Sites:

 Back to Protein Results
Gene name PTM type PTM site UV UV (MG132) Sequence
CBX4 Phosphorylation S291 0.263 0.125 _SGEVAEGEARS(ph)PSHKK_
CBX4 Phosphorylation S293 0.227 _SGEVAEGEARSPS(ph)HKK_
CBX5 Phosphorylation S14 -0.620 0.260 _RTADSSSS(ph)EDEEEYVVEK_
CBX5 Ubiquitylation K32 1.081 _VVK(gl)GQVEYLLK_
CBX5 Ubiquitylation K68 1.329 _NLDCPELISEFMK(gl)K_
CBX5 Ubiquitylation K69 0.893 _NLDCPELISEFMKK(gl)_
CBX5 Ubiquitylation K91 1.360 _K(gl)SNFSNSADDIK_
CBX5 Phosphorylation S92 0.064 -0.325 _RKS(ph)NFSNSADDIK_
CBX5 Ubiquitylation K102 1.233 1.344 _KSNFSNSADDIK(gl)SK_
CBX5 Ubiquitylation K154 0.568 0.740 _WKDTDEADLVLAK(gl)EANVK_
CDY1 Phosphorylation S201 0.003 0.069 _ILVPKS(ph)PVK_
CDY1 Phosphorylation T207 -0.948 _T(ph)AVDGFQSESPEKLDPVEQGQEDTVAPEVAAEKPVGALLGPGAER_
CDY1 Phosphorylation S216 -1.072 -1.423 _TAVDGFQSES(ph)PEKLDPVEQGQEDTVAPEVAAEKPVGALLGPGAER_
CDY1 Ubiquitylation K326 -0.134 _DQPFDK(gl)R_
CDY1 Ubiquitylation K422 0.933 0.990 _ESTK(gl)MAEAIR_
CDY1 Ubiquitylation K538 -0.054 -0.207 _IK(gl)ELASCNPVVLEESK_
CDY1 Ubiquitylation K560 0.049 _CNMK(gl)MELEQANER_
CDY1B Phosphorylation S201 0.003 0.069 _ILVPKS(ph)PVK_
CDY1B Phosphorylation T207 -0.948 _T(ph)AVDGFQSESPEKLDPVEQGQEDTVAPEVAAEKPVGALLGPGAER_
CDY1B Phosphorylation S216 -1.072 -1.423 _TAVDGFQSES(ph)PEKLDPVEQGQEDTVAPEVAAEKPVGALLGPGAER_
CDY1B Ubiquitylation K326 -0.134 _DQPFDK(gl)R_
CDY1B Ubiquitylation K422 0.933 0.990 _ESTK(gl)MAEAIR_
CDY1B Ubiquitylation K538 -0.054 -0.207 _IK(gl)ELASCNPVVLEESK_
CDY1B Ubiquitylation K560 0.049 _CNMK(gl)MELEQANER_
CDYL Phosphorylation S201 0.003 0.069 _ILVPKS(ph)PVK_
CDYL Phosphorylation T207 -0.948 _T(ph)AVDGFQSESPEKLDPVEQGQEDTVAPEVAAEKPVGALLGPGAER_
CDYL Phosphorylation S216 -1.072 -1.423 _TAVDGFQSES(ph)PEKLDPVEQGQEDTVAPEVAAEKPVGALLGPGAER_
CDYL Ubiquitylation K326 -0.134 _DQPFDK(gl)R_
CDYL Ubiquitylation K422 0.933 0.990 _ESTK(gl)MAEAIR_
CDYL Ubiquitylation K538 -0.054 -0.207 _IK(gl)ELASCNPVVLEESK_
CDYL Ubiquitylation K560 0.049 _CNMK(gl)MELEQANER_
CHD1 Phosphorylation S89 0.026 _S(ph)SPSILAVQR_
CHD1 Phosphorylation S90 0.706 -0.009 _SS(ph)PSILAVQR_
CHD1 Ubiquitylation K455 -0.198 _TTPFKDCK(gl)VLK_
CHD1 Ubiquitylation K1320 -1.450 _K(gl)EALSGAGSSK_
CHD1 Phosphorylation S1677 0.403 0.455 _ASSSGPRS(ph)PLDQR_
CHD8 Phosphorylation S557 -0.452 _VPVHQHS(ph)PSEPFLEKPVPDM(ox)TQVSGPNAQLVK_
CHD8 Ubiquitylation K1766 0.498 _EQMK(gl)IEAAER_
CHD8 Phosphorylation S1874 -0.088 -0.155 _TPFKDEIDEFANS(ph)PSEDKEESMEIHATGK_
CHD8 Phosphorylation S1978 0.606 0.061 _M(ox)NYM(ox)QNHQAGAPAPSLS(ph)R_
CHD8 Phosphorylation T1993 -1.383 -1.407 _T(ph)ASPLPLRPDAPVEKS(ph)PEETATQVPSLESLTLK_
CHD8 Phosphorylation S1995 -0.690 -1.351 _TAS(ph)PLPLRPDAPVEK_
CHD8 Phosphorylation S2008 -1.339 -1.407 _T(ph)ASPLPLRPDAPVEKS(ph)PEETATQVPSLESLTLK_
CHD8 Phosphorylation S2046 0.427 0.449 _VS(ph)PSDTTPLVSR_
CHD8 Phosphorylation S2519 -0.083 -0.552 _APGYPSS(ph)PVTTASGTTLR_
CHD8 Phosphorylation S2533 -0.792 _RTS(ph)LSAEDAEVTK_
CHD8 Phosphorylation S2559 -0.345 -0.513 _NIPS(ph)PGQLDPDTR_
CHD8 Phosphorylation S2956 0.383 -0.248 _DGETLEGS(ph)DAEESLDK_
GLYR1 Phosphorylation S152 0.506 0.350 _KLS(ph)LSEGK_
GLYR1 Ubiquitylation K340 -1.052 _TPAEVVSTCDITFACVSDPK(gl)AAK_
GLYR1 Ubiquitylation K500 1.038 _CQNILQGNFK(gl)PDFYLK_
GLYR1 Ubiquitylation K510 0.443 _YIQK(gl)DLR_
GLYR1 Ubiquitylation K540 0.176 _AK(gl)ALDQSDNDMSAVYR_
ING3 Ubiquitylation K52 0.773 _VSEFFMNAKK(gl)_
ING3 Ubiquitylation K66 0.574 _EEQMASIK(gl)K_
ING4 Ubiquitylation K114 0.730 _FEADLKEK(gl)_
KAT8 Phosphorylation S37 -2.803 _(ac)AAQGAAAAVAAGTSGVAGEGEPGPGENAAAEGTAPS(ph)PGRVS(ph)PPTPAR_
KAT8 Phosphorylation S42 -2.803 _(ac)AAQGAAAAVAAGTSGVAGEGEPGPGENAAAEGTAPS(ph)PGRVS(ph)PPTPAR_
KDM4A Ubiquitylation K105 -1.070 _IANSDK(gl)YCTPR_
KDM4A Ubiquitylation K251 -0.699 _MTLISPLMLK(gl)K_
KDM4A Ubiquitylation K252 -0.699 _MTLISPLMLK(gl)K_
KDM4A Ubiquitylation K820 -1.283 _SPVDVSK(gl)IPLPR_
KDM4A Ubiquitylation K893 -0.347 _AK(gl)GALQSITAGQK_
L3MBTL2 Phosphorylation S67 -0.335 -0.151 _EAGELPTS(ph)PLHLLSPGTPR_
L3MBTL2 Phosphorylation S85 1.566 _SLDGSGS(ph)EPAVCEM(ox)CGIVGTR_
L3MBTL2 Ubiquitylation K105 0.567 _EAFFSK(gl)TK_
L3MBTL2 Phosphorylation S688 -0.105 -0.724 _AS(ph)SPELPVSVENIK_
L3MBTL2 Phosphorylation S689 -0.279 -0.508 _ASS(ph)PELPVSVENIKQETDD_
LRWD1 Ubiquitylation K171 0.407 -0.643 _AQADFVK(gl)SAVR_
LRWD1 Phosphorylation S212 -0.942 -0.704 _ANS(ph)PEKPPEAGAAHKPR_
LRWD1 Phosphorylation S243 -0.579 -0.857 _RPDDVPLSLS(ph)PSK_
LRWD1 Phosphorylation S245 2.408 _RPDDVPLSLSPS(ph)KR_
LRWD1 Phosphorylation S251 -0.242 -0.453 _ACAS(ph)PSAQVEGS(ph)PVAGSDGSQPAVK_
LRWD1 Phosphorylation S259 -0.749 0.053 _ACAS(ph)PSAQVEGS(ph)PVAGSDGSQPAVK_
MPHOSPH8 Phosphorylation S51 0.647 0.507 _GAEAFGDS(ph)EEDGEDVFEVEK_
MPHOSPH8 Phosphorylation S85 1.839 _GYTS(ph)DDDTWEPEIHLEDCK_
MPHOSPH8 Phosphorylation S319 0.466 _AGQDMGLEHGFEKPLDSAMS(ph)AEEDTDVR_
MPHOSPH8 Phosphorylation S403 0.718 _GLWSTDS(ph)AEEDKETK_
MPHOSPH8 Ubiquitylation K623 0.189 _LLITK(gl)GAK_
MSH6 Phosphorylation S41 -0.708 -0.948 _AAAAPGAS(ph)PSPGGDAAWSEAGPGPRPLAR_
MSH6 Phosphorylation S43 0.319 -0.234 _AAAAPGASPS(ph)PGGDAAWSEAGPGPR_
MSH6 Phosphorylation S137 0.203 0.359 _VHVQFFDDS(ph)PTR_
MSH6 Phosphorylation T139 0.209 _VHVQFFDDSPT(ph)R_
MSH6 Phosphorylation S227 -0.199 -0.192 _SEEDNEIES(ph)EEEVQPK_
MSH6 Ubiquitylation K334 0.193 _QATSISSETK(gl)NTLR_
MSH6 Ubiquitylation K476 1.536 0.184 _YSDSLVQK(gl)GYK_
MSH6 Ubiquitylation K519 2.264 0.186 _IITK(gl)GTQTYSVLEGDPSENYSK_
MSH6 Ubiquitylation K728 0.082 -0.280 _SGAIFTK(gl)AYQR_
MSH6 Ubiquitylation K771 -0.582 -1.069 _VDTCHTPFGK(gl)R_
MSH6 Phosphorylation S830 0.130 1.666 _IHNVGS(ph)PLK_
MSH6 Ubiquitylation K852 -0.044 _AIMYEETTYSK(gl)K_
MSH6 Ubiquitylation K853 -0.044 _AIMYEETTYSK(gl)K_
MSH6 Ubiquitylation K896 -0.342 _QVISLQTK(gl)NPEGR_
MSH6 Ubiquitylation K997 -0.863 _NLPEEYELK(gl)STK_
MSH6 Ubiquitylation K1009 -0.817 _YWTK(gl)TIEK_
MSH6 Ubiquitylation K1030 0.394 -0.156 _DVSLK(gl)DCMR_
MSH6 Ubiquitylation K1240 -0.672 _ELAETIK(gl)CR_
MSH6 Ubiquitylation K1291 0.633 _FIK(gl)GACPK_
MSH6 Ubiquitylation K1296 -1.142 _GACPK(gl)SYGFNAAR_
MSH6 Ubiquitylation K1315 -1.738 _LANLPEEVIQK(gl)GHR_
MSH6 Ubiquitylation K1325 -0.190 _EFEK(gl)MNQSLR_
MSL3 Ubiquitylation K289 0.361 _VTSSK(gl)FFLPIK_
MSL3 Ubiquitylation K295 0.149 _FFLPIK(gl)ESATSTNR_
MSL3 Phosphorylation S400 -1.255 -0.584 _SSS(ph)PIPLTPSK_
NCAPD3 Ubiquitylation K148 -1.471 _CIQTLK(gl)K_
NCAPD3 Ubiquitylation K618 -0.418 _CVQIQK(gl)AWLR_
NCAPD3 Ubiquitylation K940 -1.230 _LCLQHEDLAKK(gl)_
NCAPD3 Ubiquitylation K1088 -1.048 _LFSLK(gl)GK_
NCAPD3 Ubiquitylation K1194 -0.642 _LISQVQK(gl)R_
NCAPD3 Phosphorylation S1382 -0.551 _SLGVLPFTLNS(ph)GSPEK_
NCAPD3 Phosphorylation S1384 -0.292 -0.404 _SLGVLPFTLNSGS(ph)PEK_
NCAPG2 Ubiquitylation K159 -0.685 _GLPAK(gl)EDTGK_
NCAPG2 Ubiquitylation K178 -0.604 0.390 _SLETK(gl)TGADVCR_
NCAPG2 Ubiquitylation K402 -1.478 _STGILGVCK(gl)ITSK_
NCAPG2 Ubiquitylation K474 -0.009 _YSLHDNSEK(gl)VR_
NCAPG2 Ubiquitylation K796 -1.745 _ALETSK(gl)ADLESLLQTPGGKPR_
NCAPG2 Ubiquitylation K809 -1.763 -1.520 _ADLESLLQTPGGK(gl)PR_
PHF13 Ubiquitylation K20 -1.737 _(ac)MDSDSCAAAFHPEEYSPSCK(gl)R_
PHF2 Phosphorylation S537 0.343 -0.072 _ES(ph)ASPTIPNLDLLEAHTK_
PHF2 Phosphorylation S539 0.502 0.405 _ESAS(ph)PTIPNLDLLEAHTK_
PHF2 Phosphorylation T541 -0.203 0.208 _SRESASPT(ph)IPNLDLLEAHTK_
PHF2 Phosphorylation S625 0.652 _LEKS(ph)PLAGNKDNK_
PHF2 Phosphorylation T654 0.359 -0.809 _ALRPPT(ph)SPGVFGALQNFK_
PHF2 Phosphorylation S655 0.281 0.100 _ALRPPTS(ph)PGVFGALQNFK_
PHF2 Phosphorylation S705 0.456 _RDLS(ph)FLLDK_
PHF2 Phosphorylation S882 -0.109 0.152 _DSDYVYPSLES(ph)DEDNPIFK_
PHF2 Phosphorylation S905 -0.242 _GSDDAPYS(ph)PTAR_
RBBP5 Ubiquitylation K157 -0.051 _DQNK(gl)VLVCPMK_
RBBP5 Ubiquitylation K207 -0.452 _RGEYIYTGNAK(gl)GK_
RBBP5 Ubiquitylation K209 -0.452 _RGEYIYTGNAK(gl)GK_
SPIN1 Phosphorylation S199 -0.289 -0.657 _IMPDSNDS(ph)PPAEREPGEVVDSLVGK_
SUZ12 Ubiquitylation K341 -0.110 -0.960 _ATWETILDGK(gl)R_
SUZ12 Ubiquitylation K390 -0.696 _NSESLHQENK(gl)PGSVKPTQTIAVK_
SUZ12 Phosphorylation S546 0.533 0.248 _ASM(ox)SEFLES(ph)EDGEVEQQR_
SUZ12 Phosphorylation S583 -0.295 _LYFHSDTCLPLRPQEMEVDS(ph)EDEKDPEWLR_
TDRD3 Phosphorylation S256 0.076 _IRS(ph)EDEEDLGNARPSAPSTLFDFLESK_
TP53BP1 Phosphorylation S119 2.253 2.083 _TSS(ph)VLGMSVESAPAVEEEKGEELEQK_
TP53BP1 Phosphorylation S265 0.355 0.274 _SEDM(ox)PFS(ph)PK_
TP53BP1 Phosphorylation S280 -0.705 _EQLS(ph)AQELMESGLQIQKSPEPEVLSTQEDLFDQSNK_
TP53BP1 Phosphorylation S287 -1.294 -1.483 _EQLSAQELMES(ph)GLQIQKSPEPEVLSTQEDLFDQSNK_
TP53BP1 Phosphorylation S294 -1.218 -0.875 _S(ph)PEPEVLSTQEDLFDQSNK_
TP53BP1 Phosphorylation S379 -0.210 _STPFIVPS(ph)SPTEQEGR_
TP53BP1 Phosphorylation S380 -0.036 -0.182 _STPFIVPSS(ph)PTEQEGR_
TP53BP1 Phosphorylation T382 -0.167 _STPFIVPSSPT(ph)EQEGR_
TP53BP1 Phosphorylation S500 0.214 0.591 _NS(ph)PEDLGLSLTGDSCK_
TP53BP1 Phosphorylation S525 -0.547 _LM(ox)LSTSEYSQS(ph)PK_
TP53BP1 Phosphorylation S552 0.102 0.080 _IDEDGENTQIEDTEPMS(ph)PVLNSK_
TP53BP1 Phosphorylation S580 1.645 1.855 _FVPAENDSILMNPAQDGEVQLS(ph)QNDDKTK_
TP53BP1 Phosphorylation S771 0.885 _VDVS(ph)CEPLEGVEK_
TP53BP1 Phosphorylation S831 2.288 2.726 _SGTAETEPVEQDSS(ph)QPSLPLVR_
TP53BP1 Phosphorylation T922 1.634 _EGDIIPPLTGAT(ph)PPLIGHLK_
TP53BP1 Phosphorylation S993 2.280 _LVS(ph)PETEASEESLQFNLEKPATGER_
TP53BP1 Phosphorylation S1028 0.901 0.869 _NGSTAVAESVAS(ph)PQK_
TP53BP1 Phosphorylation T1055 1.132 0.932 _SEDPPT(ph)TPIR_
TP53BP1 Phosphorylation T1056 0.818 0.172 _SEDPPTT(ph)PIR_
TP53BP1 Phosphorylation S1067 3.036 2.786 _GNLLHFPS(ph)SQGEEEKEK_
TP53BP1 Phosphorylation S1068 2.467 3.424 _GNLLHFPSS(ph)QGEEEKEKLEGDHTIR_
TP53BP1 Phosphorylation S1094 -1.038 _QSQQPMKPIS(ph)PVKDPVS(ph)PASQK_
TP53BP1 Phosphorylation S1101 -1.038 _QSQQPMKPIS(ph)PVKDPVS(ph)PASQK_
TP53BP1 Phosphorylation S1113 0.104 0.162 _MVIQGPS(ph)SPQGEAMVTDVLEDQK_
TP53BP1 Phosphorylation S1114 0.438 0.116 _M(ox)VIQGPSS(ph)PQGEAM(ox)VTDVLEDQK_
TP53BP1 Phosphorylation S1317 1.156 1.461 _TSS(ph)GTSLSAMHSSGSSGK_
TP53BP1 Phosphorylation S1362 0.462 0.439 _GGPGKLS(ph)PR_
TP53BP1 Phosphorylation S1426 -0.275 0.340 _ETAVPGPLGIEDIS(ph)PNLSPDDK_
TP53BP1 Phosphorylation S1430 -0.558 -0.362 _ETAVPGPLGIEDISPNLS(ph)PDDK_
TP53BP1 Phosphorylation S1460 -0.626 -0.602 _RS(ph)DSPEIPFQAAAGPSDGLDASSPGNSFVGLR_
TP53BP1 Phosphorylation S1462 -1.029 -0.981 _RSDS(ph)PEIPFQAAAGPSDGLDASSPGNSFVGLR_
TP53BP1 Phosphorylation S1618 -0.090 _AADIS(ph)LDNLVEGK_
TP53BP1 Phosphorylation S1673 -0.238 -0.008 _LITS(ph)EEERS(ph)PAK_
TP53BP1 Phosphorylation S1678 -0.242 -0.396 _LITSEEERS(ph)PAK_


.

© Copyright Svejstrup Laboratory 2015