bioLOGIC Data » bioLOGIC CategoryView » bioLOGIC VennView » Experimental Details »

bioLOGIC Data

bioLOGIC Data


Exact search


Query: CDYL

RNAi screen result RNAPII IP (PI) CSB IP CSB IP (PI) Chrom. Chrom. (PI) Phosphorylation Ubiquitylation
W
[Click on the plots to view the data selection in the respective scatterplot]

Protein Results:

 Results for post-translational modifications: see below | Red/green: hit at lower/upper end of the respective screen
Gene name Point score Z-score sums RNAi high RNAi low RNAPII-IP (PI) CSB-IP CSB-IP (PI) Chrom. Chrom. (PI)
CDYL 0 4.619 -1.020 2.440 -1.146 0.317 0.535 0.477

PTM Sites:

 Back to Protein Results | Red/green: hit at lower/upper end of the respective screen
Gene name PTM type PTM site UV UV (PI) Sequence
CDYL Ubiquitylation K422 0.933 0.990 _ESTK(gl)MAEAIR_
CDYL Phosphorylation S201 0.003 0.069 _ILVPKS(ph)PVK_
CDYL Ubiquitylation K538 -0.054 -0.207 _IK(gl)ELASCNPVVLEESK_
CDYL Phosphorylation T207 -0.948 _T(ph)AVDGFQSESPEKLDPVEQGQEDTVAPEVAAEKPVGALLGPGAER_
CDYL Phosphorylation S216 -1.072 -1.423 _TAVDGFQSES(ph)PEKLDPVEQGQEDTVAPEVAAEKPVGALLGPGAER_
CDYL Ubiquitylation K326 -0.134 _DQPFDK(gl)R_
CDYL Ubiquitylation K560 0.049 _CNMK(gl)MELEQANER_

Background Information for CDYL:


Pubmed-CDYL »
Uniprot-CDYL »
Biogrid-CDYL »
ProteomicsDB-CDYL »

Tumorportal-CDYL »
COSMIC-CDYL »
GenomeRNAi-CDYL »
Genecards-CDYL


Protein-protein Interactions for CDYL
Show screen data for Category Name and Description Link to cat description Data Source
Category members IP bait C10orf12 Cat. description Hein, Mann, Cell 2015
Category members IP bait CBX1 Cat. description Hein, Mann, Cell 2015
Category members IP bait HDAC1 Cat. description Hein, Mann, Cell 2015
Category members IP bait MYH9 Cat. description Hein, Mann, Cell 2015
Category members IP bait NOP9 Cat. description Hein, Mann, Cell 2015
Category members IP bait SRP72 Cat. description Hein, Mann, Cell 2015
Category members IP bait TPX2 Cat. description Hein, Mann, Cell 2015
Category members IP bait WIZ Cat. description Hein, Mann, Cell 2015
Category members IP bait ZNF644 Cat. description Hein, Mann, Cell 2015
Category members IP bait APOM Cat. description BioPlex, Huttlin, Gygi, Cell 2015
Category members IP bait BSG Cat. description BioPlex, Huttlin, Gygi, Cell 2015
Category members IP bait C1orf85 Cat. description BioPlex, Huttlin, Gygi, Cell 2015
Category members IP bait CD79A Cat. description BioPlex, Huttlin, Gygi, Cell 2015
Category members IP bait CDYL Cat. description BioPlex, Huttlin, Gygi, Cell 2015
Category members IP bait CYBRD1 Cat. description BioPlex, Huttlin, Gygi, Cell 2015
Category members IP bait EFNB3 Cat. description BioPlex, Huttlin, Gygi, Cell 2015
Category members IP bait FAM136A Cat. description BioPlex, Huttlin, Gygi, Cell 2015
Category members IP bait FAS Cat. description BioPlex, Huttlin, Gygi, Cell 2015
Category members IP bait HIST1H2BA Cat. description BioPlex, Huttlin, Gygi, Cell 2015
Category members IP bait KLK6 Cat. description BioPlex, Huttlin, Gygi, Cell 2015
Category members IP bait SLC15A1 Cat. description BioPlex, Huttlin, Gygi, Cell 2015
Category members IP bait TNF Cat. description BioPlex, Huttlin, Gygi, Cell 2015


Protein Domains in CDYL
Domain name Domain Description TC-NER relevance -log10(p-value)
Category members Chromo_domain/shadow IPR000953 2.84
Category members Chromodomain-like IPR016197 2.29
Category members Chromo_domain IPR023780 1.98
Category members Chromo_dom_subgr IPR017984 0.83
Category members Crotonase_core_superfam IPR001753 0.08
Category members ClpP/crotonase-like_dom IPR029045 0.08


Protein complexes (CORUM database) featuring CDYL
Category Type Category ID Category Name Data Source TC-NER relevance -log10(p-value)
Category members Corum 642 CtBP complex Database 3.6


Categories featuring CDYL
Category Type Category ID Category Name Data Source TC-NER relevance -log10(p-value)
Category members GO Category GO:0005515 protein binding Database INF
Category members GO Category GO:0005634 nucleus Database INF
Category members DDR Literature pubmedid:19647519 Paulsen et al., 2009 siRNA screen for g-H2A.x phosphorylation 3.6
Category members GO Category GO:0006351 transcription, DNA-templated Database 1.07
Category members GO Category GO:0004402 histone acetyltransferase activity Database 0.56
Category members GO Category GO:0035064 methylated histone residue binding Database 0.53
Category members GO Category GO:0003824 catalytic activity Database 0.11
Category members GO Category GO:0003714 transcription corepressor activity Database 0
Category members GO Category GO:0006355 regulation of transcription, DNA-dependent Database 0
Category members GO Category GO:0007283 spermatogenesis Database 0
Category members GO Category GO:0008152 metabolic process Database 0


.

© Copyright Svejstrup Laboratory 2015