bioLOGIC Data » bioLOGIC CategoryView » bioLOGIC VennView » Experimental Details »

bioLOGIC Data

bioLOGIC Data


Exact search


Query: CDY1

RNAi screen result RNAPII IP (PI) CSB IP CSB IP (PI) Chrom. Chrom. (PI) Phosphorylation Ubiquitylation
W
[Click on the plots to view the data selection in the respective scatterplot]

Protein Results:

 Results for post-translational modifications: see below | Red/green: hit at lower/upper end of the respective screen
Gene name Point score Z-score sums RNAi high RNAi low RNAPII-IP (PI) CSB-IP CSB-IP (PI) Chrom. Chrom. (PI)
CDY1 0 4.269 -1.150 2.090 -1.146 0.317 0.535 0.477
CDY1 0 4.269 -0.980 1.090 -1.146 0.317 0.535 0.477
CDY1 0 4.269 -0.790 0.700 -1.146 0.317 0.535 0.477
CDY1 0 4.269 0.360 -0.430 -1.146 0.317 0.535 0.477

PTM Sites:

 Back to Protein Results | Red/green: hit at lower/upper end of the respective screen
Gene name PTM type PTM site UV UV (PI) Sequence
CDY1 Ubiquitylation K422 0.933 0.990 _ESTK(gl)MAEAIR_
CDY1 Phosphorylation S201 0.003 0.069 _ILVPKS(ph)PVK_
CDY1 Ubiquitylation K538 -0.054 -0.207 _IK(gl)ELASCNPVVLEESK_
CDY1 Phosphorylation T207 -0.948 _T(ph)AVDGFQSESPEKLDPVEQGQEDTVAPEVAAEKPVGALLGPGAER_
CDY1 Phosphorylation S216 -1.072 -1.423 _TAVDGFQSES(ph)PEKLDPVEQGQEDTVAPEVAAEKPVGALLGPGAER_
CDY1 Ubiquitylation K326 -0.134 _DQPFDK(gl)R_
CDY1 Ubiquitylation K560 0.049 _CNMK(gl)MELEQANER_

Background Information for CDY1:


Pubmed-CDY1 »
Uniprot-CDY1 »
Biogrid-CDY1 »
ProteomicsDB-CDY1 »

Tumorportal-CDY1 »
COSMIC-CDY1 »
GenomeRNAi-CDY1 »
Genecards-CDY1


Protein-protein Interactions for CDY1
Show screen data for Category Name and Description Link to cat description Data Source


Protein Domains in CDY1
Domain name Domain Description TC-NER relevance -log10(p-value)
Category members Chromo_domain/shadow IPR000953 2.84
Category members Chromodomain-like IPR016197 2.29
Category members Chromo_domain IPR023780 1.98
Category members Chromo_dom_subgr IPR017984 0.83
Category members Crotonase_core_superfam IPR001753 0.08
Category members ClpP/crotonase-like_dom IPR029045 0.08


Protein complexes (CORUM database) featuring CDY1
Category Type Category ID Category Name Data Source TC-NER relevance -log10(p-value)


Categories featuring CDY1
Category Type Category ID Category Name Data Source TC-NER relevance -log10(p-value)
Category members GO Category GO:0005634 nucleus Database INF
Category members GO Category GO:0004402 histone acetyltransferase activity Database 0.56
Category members GO Category GO:0035064 methylated histone residue binding Database 0.53
Category members GO Category GO:0003824 catalytic activity Database 0.11
Category members GO Category GO:0007283 spermatogenesis Database 0
Category members GO Category GO:0008152 metabolic process Database 0


.

© Copyright Svejstrup Laboratory 2015