bioLOGIC Data » bioLOGIC CategoryView » bioLOGIC VennView » Experimental Details »

bioLOGIC Category

Results for the Category
p53 binding
(GO:0002039)

RNAi screen result RNAPII IP (MG132) CSB IP CSB IP (MG132) Chrom. Chrom. (MG132) Ubi /Phospo Ubi /Phospho (MG132)
W

Protein Results:

 Results for post-translational modifications (below)
Gene name MGoogle Score RNAi high RNAi low RNAPII-IP (MG132) CSB-IP CSB-IP (MG132) Chrom. Chrom. (MG132)
TP53BP1 2 -1.490 1.970 -0.161 -0.160 0.174
TP53BP1 2 -1.490 1.970 0.638 0.558
GSK3B 2 1.020 -0.870 -1.128 1.091
TRIM24 2 0.580 -0.300 -1.173 -0.067 -0.484 -0.364
BRD4 2 -0.320 0.280 0.080 0.220 0.614 0.191 0.117
KDM1A 1 -1.020 1.190 1.814 0.225
KDM1A 1 -1.020 1.190 0.355 0.031 0.593
SMARCB1 1 0.850 -0.060 0.041 -0.003 0.699 0.354 -0.731
SMARCB1 1 0.850 -0.060 0.738 1.594
CHD8 1 -1.310 2.760 -0.896 0.435 0.478 -1.819 -1.191
CHD8 1 -1.310 2.760 -1.168 0.026 0.297
SETD8 1 -0.030 0.060
SETD8 1 0.220 0.320
HTT 1 -0.200 -0.360 0.632 0.847 0.550
CREBBP 0 0.840 -0.950 -3.889 -1.071
MAPKAPK5 0 1.100 -0.730
RFFL 0 0.680 -0.480
SIRT1 0 0.910 -0.910
EP300 0 -1.210 1.320 -1.089 -1.694 -0.723
USP10 0 -0.120 -0.210 0.958 0.948 0.289 -0.190 -0.313
STK11 0
SMARCA4 0 -0.810 1.520 0.629 -0.158 0.141 0.337 0.333
PSME3 0 0.190 0.530 -0.215 -0.401
MDM2 0 -0.210 0.080
TRIM29 0 0.520 -0.280
TP53 0 -1.070 1.050 -2.808 0.076 -0.094 0.436 0.497
HSPD1 0 1.020 -0.650 1.151 0.719 -0.757
SETD7 0 -0.330 0.300
TAF1 0 0.381 0.385
CDKN2A 0 -0.080 -0.260 -0.556 -1.080 -3.270 -1.110
RNF20 0 1.470 -0.660 1.382 0.059 0.693 -0.069
MSX1 0 0.420 -0.450
RCHY1 0 -0.710 1.020
CDK5 0 -1.100 1.740 -0.236 1.063 0.312
TAF3 0 -0.260 -0.410 -0.724 -0.346
BRD7 0 0.610 -0.560 0.433 0.833 0.498
RFWD3 0 -0.420
CDKN2AIP 0 0.810 -0.640 -2.486 -0.718 0.428
TP53RK 0 1.015
BANP 0 -0.760 0.690 -0.628
EHMT1 0 0.540 -0.340 -0.405 0.294 0.151
USP7 0 -0.600 0.590
USP7 0 -0.600 0.590 0.789 -0.077 0.319 -0.125 0.108
BLM 0 1.270 -0.830 -0.850 -0.141 0.144 0.151 0.149
BLM 0 1.270 -0.830

PTM Sites:

 Back to Protein Results
Gene name PTM type PTM site UV UV (MG132) Sequence
BANP Ubiquitylation K331 -2.021 _GQSLAVK(gl)SFSR_
BLM Phosphorylation S144 1.234 _KLEFSSS(ph)PDSLSTINDWDDMDDFDTSETSK_
BRD4 Phosphorylation S469 -0.308 -1.544 _MPDEPEEPVVAVS(ph)SPAVPPPTK_
BRD4 Phosphorylation S470 -0.308 -0.758 _MPDEPEEPVVAVSS(ph)PAVPPPTK_
BRD4 Phosphorylation S1083 -1.699 -1.783 _EAPSPLMIHSPQMSQFQSLTHQS(ph)PPQQNVQPK_
BRD4 Phosphorylation S1117 2.833 1.857 _IHS(ph)PIIR_
BRD4 Phosphorylation S1126 1.336 0.890 _SEPFS(ph)PSLRPEPPKHPESIK_
BRD7 Phosphorylation S279 0.963 0.918 _EREDS(ph)GDAEAHAFK_
BRD7 Phosphorylation S621 -0.540 _AM(ox)GISIPS(ph)PVMENNFVDLTEDTEEPK_
CDK5 Ubiquitylation K56 0.606 0.237 _EICLLK(gl)ELK_
CHD8 Phosphorylation S557 -0.452 _VPVHQHS(ph)PSEPFLEKPVPDM(ox)TQVSGPNAQLVK_
CHD8 Ubiquitylation K1766 0.498 _EQMK(gl)IEAAER_
CHD8 Phosphorylation S1874 -0.088 -0.155 _TPFKDEIDEFANS(ph)PSEDKEESMEIHATGK_
CHD8 Phosphorylation S1978 0.606 0.061 _M(ox)NYM(ox)QNHQAGAPAPSLS(ph)R_
CHD8 Phosphorylation T1993 -1.383 -1.407 _T(ph)ASPLPLRPDAPVEKS(ph)PEETATQVPSLESLTLK_
CHD8 Phosphorylation S1995 -0.690 -1.351 _TAS(ph)PLPLRPDAPVEK_
CHD8 Phosphorylation S2008 -1.339 -1.407 _T(ph)ASPLPLRPDAPVEKS(ph)PEETATQVPSLESLTLK_
CHD8 Phosphorylation S2046 0.427 0.449 _VS(ph)PSDTTPLVSR_
CHD8 Phosphorylation S2519 -0.083 -0.552 _APGYPSS(ph)PVTTASGTTLR_
CHD8 Phosphorylation S2533 -0.792 _RTS(ph)LSAEDAEVTK_
CHD8 Phosphorylation S2559 -0.345 -0.513 _NIPS(ph)PGQLDPDTR_
CHD8 Phosphorylation S2956 0.383 -0.248 _DGETLEGS(ph)DAEESLDK_
CREBBP Phosphorylation S2093 0.037 0.097 _SIS(ph)PSALQDLLR_
EHMT1 Ubiquitylation K827 -0.048 0.076 _YLIK(gl)AGALVDPK_
EHMT1 Ubiquitylation K970 0.967 0.775 _DSDVTLKNK(gl)_
EP300 Phosphorylation S1038 -0.672 -0.349 _TEIKEEEDQPSTSATQSS(ph)PAPGQSK_
EP300 Phosphorylation S1726 0.994 0.627 _LGLGLDDESNNQQAAATQS(ph)PGDSRR_
EP300 Phosphorylation S2328 -1.092 0.725 _PQSQPPHSSPS(ph)PR_
GSK3B Phosphorylation S9 -0.483 0.010 _TTS(ph)FAESCKPVQQPSAFGSMK_
GSK3B Ubiquitylation K85 -0.204 _LCDSGELVAIK(gl)K_
GSK3B Ubiquitylation K86 -0.204 _LCDSGELVAIK(gl)K_
GSK3B Phosphorylation S215 0.296 0.477 _GEPNVS(ph)YICSR_
GSK3B Phosphorylation Y216 0.356 0.376 _GEPNVSY(ph)ICSR_
GSK3B Phosphorylation T390 2.800 2.527 _IQAAAST(ph)PTNATAASDANTGDR_
HSPD1 Phosphorylation S70 0.210 0.487 _TVIIEQSWGS(ph)PK_
HSPD1 Ubiquitylation K82 -0.300 _DGVTVAK(gl)SIDLK_
HSPD1 Ubiquitylation K87 -0.005 0.292 _SIDLK(gl)DKYK_
HSPD1 Ubiquitylation K130 -0.428 _EGFEK(gl)ISK_
HSPD1 Ubiquitylation K233 0.853 0.024 _GYISPYFINTSK(gl)GQK_
HSPD1 Ubiquitylation K292 0.339 _LK(gl)VGLQVVAVK_
HTT Ubiquitylation K260 -0.128 _AFIANLK(gl)_
HTT Phosphorylation S419 0.595 0.531 _SGS(ph)IVELIAGGGSSCS(ph)PVLSR_
HTT Phosphorylation S430 0.402 0.494 _SGSIVELIAGGGSS(ph)CSPVLSR_
HTT Phosphorylation S432 0.317 0.640 _SGSIVELIAGGGSSCS(ph)PVLSR_
HTT Phosphorylation S1195 -0.222 0.264 _EKEPGEQAS(ph)VPLSPK_
HTT Phosphorylation S1199 -0.456 -0.970 _GKEKEPGEQASVPLS(ph)PK_
HTT Ubiquitylation K1402 0.169 -0.538 _VSTQLK(gl)TNLTSVTK_
HTT Phosphorylation S1874 1.994 1.028 _LLSPQMS(ph)GEEEDSDLAAK_
KDM1A Phosphorylation S69 -2.048 -2.645 _KEPPRAS(ph)PPGGLAEPPGSAGPQAGPTVVPGSATPMETGIAETPEGR_
KDM1A Phosphorylation T88 -1.832 _KEPPRASPPGGLAEPPGSAGPQAGPT(ph)VVPGSATPM(ox)ETGIAETPEGR_
KDM1A Phosphorylation S126 0.780 0.501 _EMDES(ph)LANLSEDEYYS(ph)EEER_
KDM1A Phosphorylation S131 0.204 0.473 _EM(ox)DESLANLS(ph)EDEYYS(ph)EEER_
KDM1A Phosphorylation S137 0.122 0.511 _EM(ox)DESLANLS(ph)EDEYYS(ph)EEER_
KDM1A Phosphorylation S166 -2.328 -2.624 _KLPPPPPQAPPEEENES(ph)EPEEPSGVEGAAFQSR_
KDM1A Ubiquitylation K296 -0.820 _IKPLPTK(gl)K_
KDM1A Ubiquitylation K297 -0.820 _IKPLPTK(gl)K_
KDM1A Ubiquitylation K507 -1.073 _DITAEFLVKSK(gl)_
MAPKAPK5 Phosphorylation T182 -0.559 -0.706 _IDQGDLM(ox)T(ph)PQFTPYYVAPQVLEAQR_
MDM2 Phosphorylation S166 0.576 1.068 _AIS(ph)ETEENSDELSGER_
MDM2 Ubiquitylation K334 -0.872 _ENWLPEDK(gl)GK_
MDM2 Ubiquitylation K336 -0.872 _ENWLPEDK(gl)GK_
MDM2 Ubiquitylation K363 0.883 _LENSTQAEEGFDVPDCK(gl)K_
MDM2 Ubiquitylation K364 0.883 _LENSTQAEEGFDVPDCK(gl)K_
MDM2 Ubiquitylation K473 0.806 _NK(gl)PCPVCR_
MSX1 Phosphorylation S154 0.148 _RLS(ph)PPACTLR_
PSME3 Ubiquitylation K6 -0.128 0.024 _(ac)ASLLK(gl)VDQEVK_
PSME3 Ubiquitylation K12 0.437 _VDQEVK(gl)LK_
PSME3 Ubiquitylation K14 0.149 0.475 _LK(gl)VDSFRER_
PSME3 Phosphorylation T23 0.446 _IT(ph)SEAEDLVANFFPK_
PSME3 Phosphorylation S24 -0.264 0.279 _ITS(ph)EAEDLVANFFPK_
PSME3 Ubiquitylation K37 -0.209 _ITSEAEDLVANFFPKK(gl)_
PSME3 Ubiquitylation K132 0.536 0.916 _LLIEK(gl)CNTVK_
RCHY1 Ubiquitylation K135 0.341 _HK(gl)CIENVSR_
RFFL Phosphorylation S240 0.527 1.050 _RAS(ph)LSDLTDLEDIEGLTVR_
RFFL Phosphorylation S242 0.797 _RASLS(ph)DLTDLEDIEGLTVR_
RFWD3 Ubiquitylation K364 -0.539 0.428 _SSLLK(gl)EQMLR_
RFWD3 Ubiquitylation K583 -0.907 -0.404 _NTSSHVQELVAQK(gl)AR_
RNF20 Phosphorylation S136 -0.065 -0.170 _ALVVPEPEPDS(ph)DSNQER_
RNF20 Phosphorylation S138 -0.540 -0.691 _ALVVPEPEPDSDS(ph)NQER_
RNF20 Phosphorylation S522 -0.414 _SGSALLQS(ph)QSSTEDPKDEPAELKPDSEDLSSQSSASK_
RNF20 Phosphorylation S524 -0.171 -0.459 _SGSALLQSQS(ph)STEDPKDEPAELKPDSEDLSSQSSASK_
SETD7 Phosphorylation S3 -0.012 _(ac)MDS(ph)DDEMVEEAVEGHLDDDGLPHGFCTVTYSSTDR_
SETD8 Ubiquitylation K234 2.165 _K(gl)SKAELQSEER_
SETD8 Ubiquitylation K236 -1.450 2.341 _SK(gl)AELQSEER_
SETD8 Ubiquitylation K267 2.000 _IDLIDGK(gl)GR_
SETD8 Ubiquitylation K275 2.687 _GVIATK(gl)QFSR_
SETD8 Ubiquitylation K342 1.991 _LINHSK(gl)CGNCQTK_
SIRT1 Phosphorylation S14 -0.369 -0.246 _(ac)ADEAALALQPGGS(ph)PSAAGADR_
SIRT1 Phosphorylation S16 -0.306 -1.665 _(ac)ADEAALALQPGGS(ph)PS(ph)AAGADREAASSPAGEPLR_
SIRT1 Phosphorylation S26 -1.047 -0.245 _EAAS(ph)SPAGEPLR_
SIRT1 Phosphorylation S27 0.351 -0.363 _EAASS(ph)PAGEPLR_
SIRT1 Phosphorylation S47 -0.574 -0.607 _S(ph)PGEPGGAAPER_
SIRT1 Ubiquitylation K238 -1.641 _RK(gl)DINTIEDAVK_
SIRT1 Ubiquitylation K499 -2.138 -0.204 _LGGEYAK(gl)LCCNPVK_
SIRT1 Ubiquitylation K578 -2.782 _GCMEEK(gl)PQEVQTSR_
SIRT1 Ubiquitylation K601 -3.051 _NVESIAEQMENPDLK(gl)NVGSSTGEK_
SMARCA4 Ubiquitylation K357 -0.934 _ITPIQK(gl)PR_
SMARCA4 Ubiquitylation K405 0.109 1.148 _ATIELK(gl)ALR_
SMARCA4 Ubiquitylation K437 -0.317 _DTALETALNAK(gl)AYKR_
SMARCA4 Ubiquitylation K455 0.225 _ITEK(gl)LEK_
SMARCA4 Ubiquitylation K496 0.923 _SVTGK(gl)IQK_
SMARCA4 Phosphorylation S677 -0.880 -0.324 _KAENAEGQTPAIGPDGEPLDETSQMS(ph)DLPVK_
SMARCA4 Ubiquitylation K1283 0.125 _ILAAAK(gl)YK_
SMARCA4 Phosphorylation S1413 -0.265 0.515 _EVDYSDS(ph)LTEK_
SMARCA4 Phosphorylation S1486 -0.713 -0.935 _LS(ph)PNPPNLTK_
SMARCB1 Ubiquitylation K13 0.411 -0.949 _TFGQK(gl)PVK_
SMARCB1 Ubiquitylation K208 -0.170 _LDMEIDGQK(gl)LR_
STK11 Phosphorylation S31 0.437 0.073 _IDS(ph)TEVIYQPR_
STK11 Phosphorylation T32 1.256 0.248 _IDS(ph)TEVIYQPR_
TAF1 Phosphorylation S547 -1.176 _LLEPPVLTLDPNDENLILEIPDEKEEATSNSPS(ph)K_
TAF1 Phosphorylation S550 -1.343 _LLEPPVLTLDPNDENLILEIPDEKEEATSNSPSKES(ph)K_
TAF1 Phosphorylation S1176 0.662 1.114 _DDDTASVTS(ph)LNSSATGR_
TAF1 Phosphorylation T1703 0.001 -0.298 _DASVFQDESNM(ox)SVLDIPSAT(ph)PEK_
TAF3 Phosphorylation S183 -0.112 _RPLDS(ph)PEAEELPAMK_
TAF3 Phosphorylation S229 -1.137 _IPPMLS(ph)PVHVQDSTDLAPPS(ph)PEPPM(ox)LAPVAK_
TAF3 Phosphorylation S243 -1.351 _IPPMLS(ph)PVHVQDSTDLAPPS(ph)PEPPM(ox)LAPVAK_
TAF3 Phosphorylation S297 -0.096 0.222 _TAQSPAMVGS(ph)PIR_
TP53 Ubiquitylation K120 -0.188 _LGFLHSGTAK(gl)SVTCTYSPALNK_
TP53 Ubiquitylation K164 0.157 -1.260 _AMAIYK(gl)QSQHMTEVVR_
TP53 Phosphorylation S314 -0.695 -1.000 _ALPNNTSS(ph)SPQPK_
TP53 Phosphorylation S315 -0.762 -0.959 _RALPNNTSSS(ph)PQPK_
TP53 Ubiquitylation K320 -0.978 _ALPNNTSSSPQPKK(gl)_
TP53 Ubiquitylation K357 -0.231 -0.823 _ELNEALELKDAQAGK(gl)EPGGSR_
TP53BP1 Phosphorylation S119 2.253 2.083 _TSS(ph)VLGMSVESAPAVEEEKGEELEQK_
TP53BP1 Phosphorylation S265 0.355 0.274 _SEDM(ox)PFS(ph)PK_
TP53BP1 Phosphorylation S280 -0.705 _EQLS(ph)AQELMESGLQIQKSPEPEVLSTQEDLFDQSNK_
TP53BP1 Phosphorylation S287 -1.294 -1.483 _EQLSAQELMES(ph)GLQIQKSPEPEVLSTQEDLFDQSNK_
TP53BP1 Phosphorylation S294 -1.218 -0.875 _S(ph)PEPEVLSTQEDLFDQSNK_
TP53BP1 Phosphorylation S379 -0.210 _STPFIVPS(ph)SPTEQEGR_
TP53BP1 Phosphorylation S380 -0.036 -0.182 _STPFIVPSS(ph)PTEQEGR_
TP53BP1 Phosphorylation T382 -0.167 _STPFIVPSSPT(ph)EQEGR_
TP53BP1 Phosphorylation S500 0.214 0.591 _NS(ph)PEDLGLSLTGDSCK_
TP53BP1 Phosphorylation S525 -0.547 _LM(ox)LSTSEYSQS(ph)PK_
TP53BP1 Phosphorylation S552 0.102 0.080 _IDEDGENTQIEDTEPMS(ph)PVLNSK_
TP53BP1 Phosphorylation S580 1.645 1.855 _FVPAENDSILMNPAQDGEVQLS(ph)QNDDKTK_
TP53BP1 Phosphorylation S771 0.885 _VDVS(ph)CEPLEGVEK_
TP53BP1 Phosphorylation S831 2.288 2.726 _SGTAETEPVEQDSS(ph)QPSLPLVR_
TP53BP1 Phosphorylation T922 1.634 _EGDIIPPLTGAT(ph)PPLIGHLK_
TP53BP1 Phosphorylation S993 2.280 _LVS(ph)PETEASEESLQFNLEKPATGER_
TP53BP1 Phosphorylation S1028 0.901 0.869 _NGSTAVAESVAS(ph)PQK_
TP53BP1 Phosphorylation T1055 1.132 0.932 _SEDPPT(ph)TPIR_
TP53BP1 Phosphorylation T1056 0.818 0.172 _SEDPPTT(ph)PIR_
TP53BP1 Phosphorylation S1067 3.036 2.786 _GNLLHFPS(ph)SQGEEEKEK_
TP53BP1 Phosphorylation S1068 2.467 3.424 _GNLLHFPSS(ph)QGEEEKEKLEGDHTIR_
TP53BP1 Phosphorylation S1094 -1.038 _QSQQPMKPIS(ph)PVKDPVS(ph)PASQK_
TP53BP1 Phosphorylation S1101 -1.038 _QSQQPMKPIS(ph)PVKDPVS(ph)PASQK_
TP53BP1 Phosphorylation S1113 0.104 0.162 _MVIQGPS(ph)SPQGEAMVTDVLEDQK_
TP53BP1 Phosphorylation S1114 0.438 0.116 _M(ox)VIQGPSS(ph)PQGEAM(ox)VTDVLEDQK_
TP53BP1 Phosphorylation S1317 1.156 1.461 _TSS(ph)GTSLSAMHSSGSSGK_
TP53BP1 Phosphorylation S1362 0.462 0.439 _GGPGKLS(ph)PR_
TP53BP1 Phosphorylation S1426 -0.275 0.340 _ETAVPGPLGIEDIS(ph)PNLSPDDK_
TP53BP1 Phosphorylation S1430 -0.558 -0.362 _ETAVPGPLGIEDISPNLS(ph)PDDK_
TP53BP1 Phosphorylation S1460 -0.626 -0.602 _RS(ph)DSPEIPFQAAAGPSDGLDASSPGNSFVGLR_
TP53BP1 Phosphorylation S1462 -1.029 -0.981 _RSDS(ph)PEIPFQAAAGPSDGLDASSPGNSFVGLR_
TP53BP1 Phosphorylation S1618 -0.090 _AADIS(ph)LDNLVEGK_
TP53BP1 Phosphorylation S1673 -0.238 -0.008 _LITS(ph)EEERS(ph)PAK_
TP53BP1 Phosphorylation S1678 -0.242 -0.396 _LITSEEERS(ph)PAK_
TP53RK Phosphorylation T7 -0.376 _AT(ph)TPADGEEPAPEAEALAAAR_
TP53RK Phosphorylation T8 0.572 -0.177 _ATT(ph)PADGEEPAPEAEALAAAR_
TRIM24 Ubiquitylation K303 0.293 _IIEVNQNQK(gl)QVEQDIK_
TRIM24 Ubiquitylation K341 1.339 _MK(gl)LMQQQQEVAGLSK_
TRIM24 Phosphorylation S660 -0.300 _TVQS(ph)PNSSVPSPGLAGPVTMTSVHPPIR_
TRIM24 Phosphorylation S768 2.572 _SILTSLLLNSS(ph)QSSTSEETVLR_
TRIM24 Phosphorylation S771 3.067 _SILTSLLLNSSQSS(ph)TSEETVLR_
TRIM24 Phosphorylation S808 0.469 _SEWLDPS(ph)QKSPLHVGETR_
TRIM24 Phosphorylation S811 0.564 0.219 _SEWLDPSQKS(ph)PLHVGETR_
TRIM24 Phosphorylation S1042 2.366 1.350 _LKS(ph)IEER_
USP10 Phosphorylation S76 0.220 _TPS(ph)YSISSTLNPQAPEFILGCTASK_
USP10 Phosphorylation T208 -0.556 -0.706 _T(ph)CNSPQNSTDSVSDIVPDSPFPGALGSDTR_
USP10 Phosphorylation S211 -0.454 _TCNS(ph)PQNSTDSVSDIVPDSPFPGALGSDTR_
USP10 Phosphorylation S365 -0.539 -0.580 _YS(ph)PPAISPLVSEK_
USP10 Phosphorylation S370 0.978 0.859 _YSPPAIS(ph)PLVSEK_
USP10 Ubiquitylation K512 0.652 _LLTVNK(gl)SSLSEK_
USP10 Phosphorylation S547 0.647 0.385 _LLS(ph)PSNEK_
USP10 Phosphorylation S576 1.011 0.498 _NHSVNEEEQEEQGEGS(ph)EDEWEQVGPR_
USP10 Ubiquitylation K662 -0.003 _ESVQGYTTK(gl)TK_
USP10 Ubiquitylation K664 1.358 _TK(gl)QEVEISR_
USP10 Ubiquitylation K780 0.763 0.364 _VINQYQVVK(gl)PTAER_
USP7 Phosphorylation S18 -0.616 -0.581 _AGEQQLS(ph)EPEDM(ox)EM(ox)EAGDTDDPPR_
USP7 Ubiquitylation K158 -0.447 0.111 _IINYRDDEK(gl)SFSR_
USP7 Ubiquitylation K264 -1.350 _AVYMMPTEGDDSSK(gl)SVPLALQR_
USP7 Ubiquitylation K430 0.500 _FMYDPQTDQNIK(gl)INDR_
USP7 Ubiquitylation K605 1.273 _YTVFK(gl)VLK_
USP7 Ubiquitylation K834 -0.068 0.064 _MNYFQVAK(gl)TVAQR_
USP7 Ubiquitylation K879 -0.271 _DLLQFFK(gl)PR_
USP7 Ubiquitylation K892 0.402 0.347 _KLYYQQLK(gl)MK_
USP7 Ubiquitylation K894 0.380 _MK(gl)ITDFENRR_
USP7 Ubiquitylation K944 0.512 0.702 _KAVELGEK(gl)ASGK_
USP7 Ubiquitylation K1106 0.275 0.509 _YTYLEK(gl)AIK_


.

© Copyright Svejstrup Laboratory 2015