bioLOGIC Data » bioLOGIC CategoryView » bioLOGIC VennView » Experimental Details »

bioLOGIC Data

bioLOGIC Data


Exact search


Query: SETD7

RNAi screen result RNAPII IP (PI) CSB IP CSB IP (PI) Chrom. Chrom. (PI) Phosphorylation Ubiquitylation
W
[Click on the plots to view the data selection in the respective scatterplot]

Protein Results:

 Results for post-translational modifications: see below | Red/green: hit at lower/upper end of the respective screen
Gene name Point score Z-score sums RNAi high RNAi low RNAPII-IP (PI) CSB-IP CSB-IP (PI) Chrom. Chrom. (PI)
SETD7 0 0.288 -0.330 0.300

PTM Sites:

 Back to Protein Results | Red/green: hit at lower/upper end of the respective screen
Gene name PTM type PTM site UV UV (PI) Sequence
SETD7 Phosphorylation S3 -0.012 _(ac)MDS(ph)DDEMVEEAVEGHLDDDGLPHGFCTVTYSSTDR_

Background Information for SETD7:


Pubmed-SETD7 »
Uniprot-SETD7 »
Biogrid-SETD7 »
ProteomicsDB-SETD7 »

Tumorportal-SETD7 »
COSMIC-SETD7 »
GenomeRNAi-SETD7 »
Genecards-SETD7


Protein-protein Interactions for SETD7
Show screen data for Category Name and Description Link to cat description Data Source
Category members IP bait ARIH1 Cat. description BioPlex, Huttlin, Gygi, Cell 2015


Protein Domains in SETD7
Domain name Domain Description TC-NER relevance -log10(p-value)
Category members SET_dom IPR001214 0.29
Category members MORN IPR003409 0


Protein complexes (CORUM database) featuring SETD7
Category Type Category ID Category Name Data Source TC-NER relevance -log10(p-value)


Categories featuring SETD7
Category Type Category ID Category Name Data Source TC-NER relevance -log10(p-value)
Category members GO Category GO:0005515 protein binding Database INF
Category members GO Category GO:0005634 nucleus Database INF
Category members GO Category GO:0005694 chromosome Database 3.87
Category members Pathway Pathway_416 PID_P53_REGULATION_PATHWAY 0 2.29
Category members GO Category GO:0002039 p53 binding Database 2.06
Category members GO Category GO:0034968 histone lysine methylation Database 1.1
Category members GO Category GO:0006351 transcription, DNA-templated Database 1.07
Category members Pathway Pathway_22 KEGG_LYSINE_DEGRADATION 0 0.8
Category members GO Category GO:0018024 histone-lysine N-methyltransferase activity Database 0.73
Category members GO Category GO:0018027 peptidyl-lysine dimethylation Database 0.22
Category members GO Category GO:0016568 chromatin modification Database 0.18
Category members GO Category GO:0018026 peptidyl-lysine monomethylation Database 0.05
Category members GO Category GO:0016279 protein-lysine N-methyltransferase activity Database 0.04
Category members GO Category GO:0006355 regulation of transcription, DNA-dependent Database 0


.

© Copyright Svejstrup Laboratory 2015