bioLOGIC Data » bioLOGIC CategoryView » bioLOGIC VennView » Experimental Details »
bioLOGIC Category

Results for the Category
peptidyl-lysine dimethylation
(GO:0018027)

RNAi screen result RNAPII IP (MG132) CSB IP CSB IP (MG132) Chrom. Chrom. (MG132) Ubi /Phospo Ubi /Phospho (MG132)
W

Protein Results:

Results for post-translational modifications (below)
Gene name MGoogle Score RNAi high RNAi low RNAPII-IP (MG132) CSB-IP CSB-IP (MG132) Chrom. Chrom. (MG132)
SETD3 1 -0.570 0.790 4.968 0.048
SETD7 0 -0.330 0.300
EHMT1 0 0.540 -0.340 -0.405 0.294 0.151

PTM Sites:

Back to Protein Results
Gene name PTM type PTM site UV UV (MG132) Sequence
EHMT1 Ubiquitylation K827 -0.048 0.076 _YLIK(gl)AGALVDPK_
EHMT1 Ubiquitylation K970 0.967 0.775 _DSDVTLKNK(gl)_
SETD3 Ubiquitylation K439 -0.319 _ASLLLK(gl)TYK_
SETD7 Phosphorylation S3 -0.012 _(ac)MDS(ph)DDEMVEEAVEGHLDDDGLPHGFCTVTYSSTDR_


© Copyright Svejstrup Laboratory 2015