bioLOGIC Data » bioLOGIC CategoryView » bioLOGIC VennView » Experimental Details »
bioLOGIC Category

Results for the Category
chromatin modification
(GO:0016568)

RNAi screen result RNAPII IP (MG132) CSB IP CSB IP (MG132) Chrom. Chrom. (MG132) Ubi /Phospo Ubi /Phospho (MG132)
W

Protein Results:

Results for post-translational modifications (below)
Gene name MGoogle Score RNAi high RNAi low RNAPII-IP (MG132) CSB-IP CSB-IP (MG132) Chrom. Chrom. (MG132)
HIRA 2 -1.620 2.740 0.660 0.537 0.081
WHSC1 2 1.030 -0.990
EYA4 2 -0.120 0.100
DEK 2 -0.440 0.780 1.393 0.327 0.634 0.738 0.313
DNMT1 2 0.150 -0.150 0.077 -0.109 -1.422 0.572
DNMT1 2 0.150 -0.150 0.134 -0.347 -0.054
EPC2 2 2.090 -1.260 1.642 0.412
C11orf30 2 -0.580 1.010 0.284 0.278 0.014
SMARCAD1 2 0.070 0.540 -0.030 1.060 0.612 0.381 0.353
HDAC9 1 -1.710 3.420
RBL1 1 0.270 -0.950
C22orf39 1 0.860 -0.580 0.660 0.537 0.081
L3MBTL2 1 0.230 0.100 -0.842 -0.492 0.272
MRGBP 1 3.060 -1.260 -0.369 0.872
CTCF 1 -0.190 0.040 1.656 0.503 0.229 0.942 0.519
DNAJC2 1 -1.580 2.610 -0.006 -0.151 -0.913
DNAJC2 1 -0.640 0.410 -0.006 -0.151 -0.913
H2AFY 1 0.440 0.350 -0.717 0.162 0.382
HDAC1 1 -1.980 4.450
HDAC1 1 -1.980 4.450 -0.122 0.307 0.969 0.094 0.191
HMGN3 1 0.310 -0.590 -1.537 -1.454
KDM4B 1 -0.310 -0.360
HAT1 1 -1.060 1.530 1.641
UTP3 1 -0.530 0.510 -0.533 0.181
SMARCAL1 1 -1.220 1.410 1.748
TDG 1 1.400 -0.150
LRWD1 1 0.490 -0.390 -0.233 0.037 0.364 0.157 0.333
VPS72 1 2.120 -1.200 -0.447 -0.072
BRD9 0 1.830 -0.980 -0.119 -0.100
HDAC7 0 -0.840 1.260
HMG20B 0 -0.570 0.110
HDAC4 0 1.730 -0.740
HLTF 0 0.090 0.760 -1.266 -1.379 -0.452 0.279 0.321
HLTF 0 0.090 0.760
KDM5A 0 0.183 -0.131
TDRD3 0 -1.210 1.400 0.288 1.145
BCORL1 0 0.020 0.200 0.066 0.099
BCORL1 0 0.020 0.200 -0.065
H2AFY2 0 0.600 -0.650 0.895 0.516
CABIN1 0 -1.150 0.740 1.085 -0.018
RBL2 0 0.890 -0.800
ASF1B 0 -0.590 0.490
BABAM1 0
HDAC5 0 -0.830 1.270
CHD4 0 0.740 -0.710 -2.910 -0.998 -0.326
CHD4 0 0.740 -0.710 0.187 0.222 0.572 0.098 0.155
ASF1A 0 0.310 -0.850
NR3C1 0 0.390 -0.260
PHF13 0 0.540 -0.820
UBN1 0 1.460 -0.610
KDM3B 0 0.646 -1.094
MORF4L2 0 0.230 -0.110 0.343 -0.996 -1.451
RRP8 0 0.000 0.030 -0.172 0.390
RCBTB1 0 -0.280 1.030
TET1 0 0.570 0.030
AEBP2 0 0.100 0.240
HMG20A 0 0.790 -0.810 1.137 0.647 0.779 -0.386 0.078
NCOR1 0 -0.820 1.130 -0.827 -0.215 0.037
CBX4 0 0.230 0.160 0.798 0.323
MTF2 0 1.093 0.072
SETD7 0 -0.330 0.300
TLK2 0 -0.170 -0.340 0.092
TAF5 0 1.390 -1.390 -2.311 0.004 0.398 1.017 0.674
BRE 0 -1.690 2.290 0.053 0.191 -0.048 0.149
BRE 0 -1.690 2.290 -1.215
FAM175A 0 -1.160 1.510
HDAC11 0 -1.480 2.420
HDAC11 0 -1.480 2.420
BMI1 0 0.900 -1.150 0.182
BRD3 0 -0.570 0.450 0.293 0.252
CHD3 0 -1.560 2.320 -2.910 -0.998 -0.326
CHD3 0 -1.560 2.320 0.225 0.227 0.558
CHD3 0 -1.560 2.320 0.549 0.482
CHD7 0 0.220 -0.050 -1.168 0.026 0.297
HDAC3 0 -0.790 1.070
JMJD1C 0 -0.430 0.080
BANP 0 -0.760 0.690 -0.628
CHD9 0 -0.540 1.270 -0.628 -0.221
CHD9 0 -0.540 1.270
TBL1XR1 0 -0.370 0.750 0.090 -3.400 0.909 0.103 0.241
EHMT1 0 0.540 -0.340 -0.405 0.294 0.151
CBX6 0 1.520 -1.160
ARID2 0 0.220 -0.610 0.713 -0.130 0.978 0.294 0.323
HMGN5 0 0.120 -0.720 -1.319 -0.947
TLK1 0 1.190 -1.120
C17orf49 0 0.008 0.869
C17orf49 0

PTM Sites:

Back to Protein Results
Gene name PTM type PTM site UV UV (MG132) Sequence
AEBP2 Phosphorylation S24 -1.401 _(ac)AAAITDMADLEELS(ph)RLSPLPPGS(ph)PGSAAR_
AEBP2 Phosphorylation S141 -0.086 0.133 _SLS(ph)PGAASSSSGDGDGKEGLEEPK_
AEBP2 Phosphorylation S206 0.362 0.392 _RGS(ph)LEMSSDGEPLSR_
AEBP2 Phosphorylation S390 0.707 _S(ph)LPRPHDFFDAQTLDAIR_
ARID2 Ubiquitylation K7 0.027 _(ac)ANSTGK(gl)APPDER_
ARID2 Ubiquitylation K581 0.093 _TVFPNHTVK(gl)R_
ARID2 Phosphorylation S689 -0.677 -1.105 _IPQNPS(ph)PHTHQQQNAPVTVIQSK_
ARID2 Ubiquitylation K1241 0.826 _GDK(gl)IICQK_
ASF1A Phosphorylation S165 0.476 0.047 _LEDAES(ph)SNPNLQSLLSTDALPSASK_
ASF1A Phosphorylation S166 -0.537 _FHINWEDNTEKLEDAESS(ph)NPNLQSLLSTDALPSASK_
ASF1B Ubiquitylation K129 -1.048 -1.953 _ENPPMK(gl)PDFSQLQR_
ASF1B Phosphorylation T179 0.018 _LEAIETQDPSLGCGLPLNCT(ph)PIK_
BABAM1 Phosphorylation S7 -0.774 -0.248 _M(ox)EVAEPS(ph)S(ph)PTEEEEEEEEHSAEPR_
BABAM1 Phosphorylation S8 -0.593 -0.317 _(ac)MEVAEPSS(ph)PTEEEEEEEEHSAEPRPR_
BABAM1 Phosphorylation T10 -0.435 -0.371 _(ac)MEVAEPSSPT(ph)EEEEEEEEHSAEPR_
BABAM1 Phosphorylation S49 0.284 0.198 _S(ph)EGEGEAASADDGSLNTSGAGPK_
BABAM1 Phosphorylation T65 -0.439 _SEGEGEAASADDGSLNT(ph)SGAGPK_
BABAM1 Phosphorylation S66 0.479 -0.294 _SEGEGEAASADDGSLNTS(ph)GAGPK_
BABAM1 Ubiquitylation K117 -0.415 -0.148 _LESFNGSK(gl)TNALNVSQK_
BANP Ubiquitylation K331 -2.021 _GQSLAVK(gl)SFSR_
BCORL1 Ubiquitylation K219 -1.061 _LASSDTMK(gl)R_
BCORL1 Phosphorylation S613 -0.406 _EMAS(ph)PPECSEMPLDLSSK_
BCORL1 Phosphorylation S1033 0.926 -0.297 _RGS(ph)STERPQLGSQVDLGR_
BRD3 Phosphorylation T249 -0.461 _ADTT(ph)TPTTSAITASR_
BRD3 Phosphorylation T250 -0.189 _ADTTT(ph)PTTSAITASR_
BRD3 Phosphorylation S263 -0.787 -0.714 _SES(ph)PPPLSDPK_
BRD9 Ubiquitylation K460 -0.374 _TLFQLK(gl)QR_
BRD9 Phosphorylation S588 -0.656 -0.990 _LSVGEQPDVTHDPYEFLQS(ph)PEPAASAK_
BRE Ubiquitylation K26 -0.928 _NGK(gl)VGLDATNCLR_
BRE Ubiquitylation K41 -0.768 -0.586 _ITDLK(gl)SGCTSLTPGPNCDR_
BRE Ubiquitylation K162 0.838 _K(gl)NNWTGEFSAR_
C11orf30 Phosphorylation S188 -0.670 _PAS(ph)PASNVVVLPSGSTVYVK_
C11orf30 Phosphorylation S224 0.591 _TNS(ph)SSSSPVVLK_
C11orf30 Ubiquitylation K965 -1.670 _SALTQSQSAK(gl)QQK_
C11orf30 Ubiquitylation K968 -1.309 _SALTQSQSAKQQK(gl)_
C11orf30 Phosphorylation S1145 2.371 1.802 _LTS(ph)PVTSISPIQASEK_
C17orf49 Phosphorylation S76 -0.693 -0.492 _LGELTMQLHPVADS(ph)SPAGAK_
C17orf49 Phosphorylation S77 -0.644 -0.371 _LGELTMQLHPVADSS(ph)PAGAK_
C17orf49 Phosphorylation S137 -0.589 -0.859 _VYEDSGIPLPAES(ph)PKKGPK_
C17orf49 Phosphorylation S147 -1.632 -1.957 _VAS(ph)GVLSPPPAAPPPSSSSVPEAGGPPIK_
C17orf49 Phosphorylation S151 -1.596 -2.794 _VASGVLS(ph)PPPAAPPPSSSSVPEAGGPPIK_
C22orf39 Phosphorylation T542 0.649 _DSM(ox)NAT(ph)STPAALSPSVLTTPSK_
C22orf39 Phosphorylation S549 0.985 0.496 _DSM(ox)NATSTPAALS(ph)PSVLTTPSK_
C22orf39 Phosphorylation S661 2.076 0.577 _LMPVSLSVQS(ph)PAALTAEK_
CABIN1 Ubiquitylation K198 -0.715 _GLVLK(gl)EK_
CBX4 Phosphorylation S291 0.263 0.125 _SGEVAEGEARS(ph)PSHKK_
CBX4 Phosphorylation S293 0.227 _SGEVAEGEARSPS(ph)HKK_
CBX6 Ubiquitylation K33 -0.153 _WK(gl)GWAIK_
CBX6 Ubiquitylation K100 -0.870 _ISDVHFSVK(gl)PSASASSPK_
CBX6 Phosphorylation S102 -0.668 _ISDVHFSVKPS(ph)ASASSPK_
CBX6 Phosphorylation S107 -0.886 -0.601 _ISDVHFSVKPSASASS(ph)PK_
CBX6 Phosphorylation S280 -2.280 -1.542 _SSGSSGCPS(ph)PTPQSSDPDDTPPK_
CBX6 Phosphorylation S301 0.842 _LLPETVS(ph)PSAPSWR_
CHD3 Phosphorylation S402 0.539 _EGIQWEAKEDNS(ph)EGEEILEEVGGDLEEEDDHHMEFCR_
CHD3 Phosphorylation S489 -1.030 -2.127 _WGQPPS(ph)PTPVPRPPDADPNTPSPK_
CHD3 Phosphorylation T491 -2.659 _WGQPPS(ph)PTPVPRPPDADPNTPSPK_
CHD3 Phosphorylation S772 -0.647 -1.419 _KELQGDGPPSS(ph)PTNDPTVK_
CHD3 Phosphorylation T774 -0.442 _ELQGDGPPSSPT(ph)NDPTVK_
CHD3 Phosphorylation S1509 -0.565 -0.704 _MSQPGS(ph)PSPK_
CHD3 Phosphorylation T1514 -1.082 _T(ph)PTPSTPGDTQPNTPAPVPPAEDGIK_
CHD3 Phosphorylation T1519 -1.446 _TPTPST(ph)PGDTQPNTPAPVPPAEDGIK_
CHD3 Phosphorylation T1527 -2.218 -2.475 _TPTPS(ph)TPGDTQPNT(ph)PAPVPPAEDGIK_
CHD3 Phosphorylation S1544 1.206 1.130 _IEENS(ph)LKEEESIEGEK_
CHD3 Phosphorylation S1660 -0.273 -0.515 _METEADAPS(ph)PAPSLGER_
CHD4 Phosphorylation S402 0.539 _EGIQWEAKEDNS(ph)EGEEILEEVGGDLEEEDDHHMEFCR_
CHD4 Phosphorylation S489 -1.030 -2.127 _WGQPPS(ph)PTPVPRPPDADPNTPSPK_
CHD4 Phosphorylation T491 -2.659 _WGQPPS(ph)PTPVPRPPDADPNTPSPK_
CHD4 Ubiquitylation K884 0.702 _NNQSK(gl)FFR_
CHD4 Ubiquitylation K959 -0.609 _LK(gl)ADVFK_
CHD4 Phosphorylation S1509 -0.565 -0.704 _MSQPGS(ph)PSPK_
CHD4 Phosphorylation T1514 -1.082 _T(ph)PTPSTPGDTQPNTPAPVPPAEDGIK_
CHD4 Phosphorylation T1519 -1.446 _TPTPST(ph)PGDTQPNTPAPVPPAEDGIK_
CHD4 Phosphorylation T1527 -2.218 -2.475 _TPTPS(ph)TPGDTQPNT(ph)PAPVPPAEDGIK_
CHD4 Phosphorylation S1544 1.206 1.130 _IEENS(ph)LKEEESIEGEK_
CHD4 Ubiquitylation K1778 0.999 _GNFLEIK(gl)NK_
CHD4 Ubiquitylation K1780 0.999 _GNFLEIK(gl)NK_
CHD4 Ubiquitylation K1844 -0.796 _ESMAGNK(gl)PANAVLHK_
CHD4 Ubiquitylation K1865 -0.216 _QLEELLSDMK(gl)ADVTR_
CHD7 Phosphorylation S557 -0.452 _VPVHQHS(ph)PSEPFLEKPVPDM(ox)TQVSGPNAQLVK_
CHD7 Phosphorylation S1874 -0.088 -0.155 _TPFKDEIDEFANS(ph)PSEDKEESMEIHATGK_
CHD7 Phosphorylation S2533 -0.792 _RTS(ph)LSAEDAEVTK_
CHD7 Phosphorylation S2559 -0.345 -0.513 _NIPS(ph)PGQLDPDTR_
CHD7 Phosphorylation S2956 0.383 -0.248 _DGETLEGS(ph)DAEESLDK_
CHD9 Phosphorylation S550 -0.232 _VMS(ph)PENFPTASVEGK_
DEK Phosphorylation T13 -0.652 -0.453 _(ac)SASAPAAEGEGT(ph)PTQPASEK_
DEK Phosphorylation S32 0.303 0.281 _EPEMPGPREES(ph)EEEEDEDDEEEEEEEKEK_
DEK Ubiquitylation K57 1.574 _SLIVEGK(gl)R_
DEK Ubiquitylation K84 1.492 _EPFTIAQGK(gl)GQK_
DEK Ubiquitylation K125 0.685 _K(gl)NVGQFSGFPFEK_
DEK Ubiquitylation K177 1.939 1.451 _SGVNSELVK(gl)R_
DEK Ubiquitylation K371 1.418 _TTVK(gl)ELIS_
DNAJC2 Phosphorylation S47 0.625 0.452 _NAS(ph)ASFQELEDK_
DNMT1 Phosphorylation S127 -0.755 -0.836 _VGM(ox)ADANS(ph)PPKPLSKPR_
DNMT1 Phosphorylation S143 0.877 0.220 _SKS(ph)DGEAKPEPSPSPR_
DNMT1 Phosphorylation S152 -0.685 -1.347 _SDGEAKPEPS(ph)PSPR_
DNMT1 Phosphorylation S154 -1.926 -0.876 _SDGEAKPEPSPS(ph)PR_
DNMT1 Ubiquitylation K586 1.686 3.368 _DLIK(gl)LAGVTLGQR_
DNMT1 Ubiquitylation K675 1.267 0.915 _DMVK(gl)FGGSGR_
DNMT1 Phosphorylation S714 -0.773 -0.554 _EADDDEEVDDNIPEMPS(ph)PKK_
DNMT1 Phosphorylation S954 -0.318 0.057 _LSS(ph)PVKRPR_
DNMT1 Ubiquitylation K961 -3.166 _K(gl)EPVDEDLYPEHYR_
DNMT1 Ubiquitylation K981 -0.298 -1.482 _YSDYIK(gl)GSNLDAPEPYR_
DNMT1 Ubiquitylation K997 0.042 0.154 _IK(gl)EIFCPK_
DNMT1 Ubiquitylation K1483 1.983 -0.103 _GVCSCVEAGK(gl)ACDPAAR_
EHMT1 Ubiquitylation K827 -0.048 0.076 _YLIK(gl)AGALVDPK_
EHMT1 Ubiquitylation K970 0.967 0.775 _DSDVTLKNK(gl)_
EYA4 Phosphorylation S4 2.607 2.311 _(ac)M(ox)EDS(ph)QDLNEQSVK_
EYA4 Phosphorylation S367 -1.041 -1.090 _NNPS(ph)PPPDSDLER_
EYA4 Ubiquitylation K513 -0.108 _NNVGGLLGPAK(gl)R_
EYA4 Ubiquitylation K587 -1.219 _IGK(gl)ESCFER_
FAM175A Ubiquitylation K368 -0.236 _LLDTQDK(gl)R_
FAM175A Ubiquitylation K398 -1.202 _MK(gl)GFGEYSR_
FAM175A Phosphorylation S406 0.645 0.695 _GFGEYSRS(ph)PTF_
H2AFY Ubiquitylation K116 -0.551 0.254 _GVTIASGGVLPNIHPELLAK(gl)K_
H2AFY Ubiquitylation K117 -0.333 -0.043 _GVTIASGGVLPNIHPELLAKK(gl)_
H2AFY Ubiquitylation K121 -0.646 -0.167 _GSK(gl)GKLEAIITPPPAKK_
H2AFY Ubiquitylation K123 -0.548 -0.558 _GK(gl)LEAIITPPPAKK_
H2AFY Phosphorylation T129 -1.725 -1.166 _LEAIIT(ph)PPPAK_
H2AFY Ubiquitylation K167 0.462 _QGEVSK(gl)AASADSTTEGTPADGFTVLSTK_
H2AFY Phosphorylation S170 0.502 _AAS(ph)ADSTTEGTPADGFTVLSTK_
H2AFY Phosphorylation T178 0.817 0.888 _AASADSTTEGT(ph)PADGFTVLSTK_
H2AFY Ubiquitylation K292 1.109 _CEELLEK(gl)TVK_
H2AFY Ubiquitylation K295 1.067 1.894 _TVK(gl)NCLALADDKK_
H2AFY Ubiquitylation K304 1.053 0.925 _NCLALADDK(gl)K_
H2AFY Ubiquitylation K305 0.941 _NCLALADDKK(gl)_
H2AFY Ubiquitylation K307 0.761 -0.193 _LK(gl)SIAFPSIGSGR_
H2AFY Ubiquitylation K323 0.614 _NGFPK(gl)QTAAQLILK_
H2AFY2 Ubiquitylation K116 0.566 0.180 _GVTIASGGVLPRIHPELLAK(gl)K(gl)_
H2AFY2 Ubiquitylation K117 0.174 -0.019 _GVTIASGGVLPRIHPELLAK(gl)K(gl)_
H2AFY2 Ubiquitylation K123 -0.721 -0.453 _GK(gl)SETILSPPPEKR_
HAT1 Ubiquitylation K15 0.648 0.417 _FLVEYK(gl)SAVEKK_
HAT1 Ubiquitylation K21 0.254 _FLVEYK(gl)SAVEKK(gl)_
HAT1 Ubiquitylation K26 0.102 0.413 _LAEYK(gl)CNTNTAIELK_
HAT1 Ubiquitylation K110 0.099 _VDENFDCVEADDVEGK(gl)IR_
HAT1 Phosphorylation S361 0.536 0.646 _LIS(ph)PYKK_
HDAC1 Ubiquitylation K50 0.036 _K(gl)MEIYRPHK_
HDAC1 Ubiquitylation K66 -0.593 _ANAEEMTK(gl)YHSDDYIK_
HDAC1 Ubiquitylation K74 0.620 -1.473 _YHSDDYIK(gl)FLR_
HDAC1 Ubiquitylation K89 0.749 -0.241 _SIRPDNMSEYSK(gl)QMQR_
HDAC1 Phosphorylation S393 -1.133 -1.144 _M(ox)LPHAPGVQM(ox)QAIPEDAIPEES(ph)GDEDEDDPDKR_
HDAC1 Phosphorylation S409 1.326 1.144 _ISICS(ph)SDKR_
HDAC1 Phosphorylation S410 1.326 1.144 _ISICS(ph)SDKR_
HDAC1 Ubiquitylation K412 0.642 -0.744 _ISICSSDK(gl)R_
HDAC11 Ubiquitylation K50 1.042 _VINFLK(gl)EEK_
HDAC11 Phosphorylation S121 -0.871 -0.105 _SPSS(ph)FCLSVWR_
HDAC3 Phosphorylation S424 -0.354 _GPEENYSRPEAPNEFYDGDHDNDKES(ph)DVEI_
HDAC4 Phosphorylation S265 -0.390 _RS(ph)SPLLR_
HDAC4 Phosphorylation S266 -0.821 -0.598 _RSS(ph)PLLR_
HDAC4 Phosphorylation S632 -1.146 -0.837 _AQS(ph)SPASATFPVSVQEPPTKPR_
HDAC5 Phosphorylation S265 -0.390 _RS(ph)SPLLR_
HDAC5 Phosphorylation S266 -0.821 -0.598 _RSS(ph)PLLR_
HDAC7 Phosphorylation S181 -0.436 0.447 _KES(ph)APPSLR_
HDAC7 Phosphorylation S486 -0.969 -0.754 _AQS(ph)SPAAPASLSAPEPASQAR_
HDAC9 Phosphorylation S265 -0.390 _RS(ph)SPLLR_
HDAC9 Phosphorylation S266 -0.821 -0.598 _RSS(ph)PLLR_
HIRA Phosphorylation T542 0.649 _DSM(ox)NAT(ph)STPAALSPSVLTTPSK_
HIRA Phosphorylation S549 0.985 0.496 _DSM(ox)NATSTPAALS(ph)PSVLTTPSK_
HIRA Phosphorylation S661 2.076 0.577 _LMPVSLSVQS(ph)PAALTAEK_
HLTF Ubiquitylation K95 -1.182 -1.582 _DPNNPYDK(gl)NAIK_
HLTF Ubiquitylation K349 0.801 _LGGNNTSEK(gl)ADGLSK_
HLTF Ubiquitylation K682 -1.157 0.020 _IYQSVK(gl)NEGR_
HLTF Ubiquitylation K889 0.024 _LDGSMAQKK(gl)_
HLTF Ubiquitylation K952 0.264 _LGQK(gl)QEVIITK_
HLTF Ubiquitylation K988 -1.543 _ELAAGAFGTK(gl)KPNADEMK_
HLTF Ubiquitylation K999 0.178 -1.364 _QAK(gl)INEIR_
HMG20A Phosphorylation S105 0.508 0.515 _S(ph)PLTGYVR_
HMG20A Phosphorylation T108 0.498 _DSNAPKSPLT(ph)GYVR_
HMG20A Ubiquitylation K255 1.175 _NAALQK(gl)HVESMR_
HMG20B Phosphorylation T167 0.485 0.715 _EDS(ph)SSGLMNT(ph)LLNGHK_
HMGN3 Phosphorylation T10 -0.157 _RKSPENT(ph)EGK_
HMGN3 Phosphorylation S31 -1.777 -1.714 _LS(ph)AKPAPPKPEPK_
HMGN3 Ubiquitylation K33 -1.736 _LSAK(gl)PAPPKPEPKPR_
HMGN3 Phosphorylation S78 3.475 _EGTAPS(ph)ENGETKAEEAQK_
HMGN3 Phosphorylation S93 0.325 0.602 _AEEAQKTES(ph)VDNEGE_
JMJD1C Phosphorylation S943 -0.429 -0.212 _ITAHSS(ph)PPLTK_
JMJD1C Phosphorylation S1185 0.452 0.810 _NDCRS(ph)PTHLTVSSTNTLR_
JMJD1C Phosphorylation T1187 0.467 _NDCRS(ph)PTHLTVSSTNTLR_
JMJD1C Phosphorylation S2005 -0.899 -1.455 _LTPPES(ph)QSPLHWLADLAEQK_
JMJD1C Phosphorylation S2007 -0.154 -0.813 _LTPPESQS(ph)PLHWLADLAEQK_
JMJD1C Phosphorylation T2052 -0.154 0.770 _T(ph)SPLVSQNNEQGSTLR_
JMJD1C Phosphorylation S2053 0.101 0.770 _T(ph)SPLVSQNNEQGSTLR_
KDM3B Ubiquitylation K11 -0.645 _(ac)ADAAASPVGK(gl)R_
KDM3B Ubiquitylation K570 -1.152 _QSLESLSSGLCK(gl)GR_
KDM3B Ubiquitylation K580 -1.565 0.147 _SVLGTDTK(gl)PGSK_
KDM3B Ubiquitylation K584 -0.786 _SVLGTDTKPGSK(gl)AGSSVDR_
KDM4B Ubiquitylation K302 0.088 _WIDYGK(gl)VATQCTCR_
KDM4B Ubiquitylation K334 -0.129 _YELWK(gl)QGK_
KDM4B Phosphorylation S600 0.260 _EPVS(ph)PMELTGPEDGAASSGAGR_
KDM4B Ubiquitylation K638 -0.589 _AGEGQAPSTFSKLK(gl)_
KDM4B Ubiquitylation K962 0.437 _AVSLGQVVITK(gl)NR_
KDM4B Ubiquitylation K1028 -0.559 _WTDGNLYK(gl)AK_
KDM4B Ubiquitylation K1030 -0.709 _WTDGNLYKAK(gl)_
KDM4B Phosphorylation T1099 2.839 -0.307 _VGT(ph)PLATEDSGR_
KDM5A Ubiquitylation K135 -0.691 _GGFEMVTK(gl)EK_
KDM5A Ubiquitylation K137 -0.691 _GGFEMVTK(gl)EK_
KDM5A Ubiquitylation K159 -0.589 _GTGSLLK(gl)SHYER_
KDM5A Ubiquitylation K805 -0.328 _EAETCASVAQLLLSKK(gl)_
KDM5A Phosphorylation S1111 -0.424 0.369 _DLDLEPLS(ph)DLEEGLEETR_
KDM5A Phosphorylation S1666 -1.341 _KQGPVS(ph)PGPAPPPSFIMSYK_
L3MBTL2 Phosphorylation S67 -0.335 -0.151 _EAGELPTS(ph)PLHLLSPGTPR_
L3MBTL2 Phosphorylation S85 1.566 _SLDGSGS(ph)EPAVCEM(ox)CGIVGTR_
L3MBTL2 Ubiquitylation K105 0.567 _EAFFSK(gl)TK_
L3MBTL2 Phosphorylation S688 -0.105 -0.724 _AS(ph)SPELPVSVENIK_
L3MBTL2 Phosphorylation S689 -0.279 -0.508 _ASS(ph)PELPVSVENIKQETDD_
LRWD1 Ubiquitylation K171 0.407 -0.643 _AQADFVK(gl)SAVR_
LRWD1 Phosphorylation S212 -0.942 -0.704 _ANS(ph)PEKPPEAGAAHKPR_
LRWD1 Phosphorylation S243 -0.579 -0.857 _RPDDVPLSLS(ph)PSK_
LRWD1 Phosphorylation S245 2.408 _RPDDVPLSLSPS(ph)KR_
LRWD1 Phosphorylation S251 -0.242 -0.453 _ACAS(ph)PSAQVEGS(ph)PVAGSDGSQPAVK_
LRWD1 Phosphorylation S259 -0.749 0.053 _ACAS(ph)PSAQVEGS(ph)PVAGSDGSQPAVK_
MORF4L2 Ubiquitylation K49 -1.473 -0.862 _TAGPQQK(gl)NLEPALPGR_
MORF4L2 Phosphorylation S71 -0.901 -0.742 _SAENPPSGS(ph)VRK_
MORF4L2 Ubiquitylation K116 -0.683 0.546 _ADPTVESEEAFK(gl)NR_
MORF4L2 Ubiquitylation K152 -0.601 _QLFQLPAK(gl)K_
MORF4L2 Ubiquitylation K153 -0.285 _QLFQLPAKK(gl)_
MRGBP Phosphorylation S194 -0.960 _VLTANSNPS(ph)SPSAAK_
MRGBP Phosphorylation S195 -0.780 -1.496 _VLTANSNPSS(ph)PSAAK_
NCOR1 Phosphorylation S1195 -0.029 0.716 _MPIEDS(ph)SPEKGREEAASK_
NCOR1 Phosphorylation S1196 0.087 0.141 _MPIEDSS(ph)PEKGR_
NCOR1 Phosphorylation S1472 0.700 0.536 _AQLS(ph)PGIYDDTSAR_
NCOR1 Phosphorylation S1977 -0.959 -0.974 _YETPSDAIEVIS(ph)PASSPAPPQEK_
NCOR1 Ubiquitylation K1998 -2.086 _LQTYQPEVVK(gl)ANQAENDPTR_
NCOR1 Phosphorylation S2120 0.148 0.154 _VS(ph)PENLVDK_
NCOR1 Phosphorylation S2151 -1.006 -0.922 _SHVSSEPYEPIS(ph)PPQVPVVHEK_
NCOR1 Phosphorylation S2184 0.120 0.226 _S(ph)PGSISYLPSFFTK_
NCOR1 Phosphorylation S2187 0.396 _SPGS(ph)ISYLPSFFTK_
NR3C1 Phosphorylation S45 -0.810 -0.399 _VSASS(ph)PSLAVASQSDSK_
NR3C1 Phosphorylation S226 -0.070 _SDLLIDENCLLS(ph)PLAGEDDSFLLEGNSNEDCKPLILPDTKPK_
NR3C1 Ubiquitylation K696 0.338 _MTYIK(gl)ELGK_
PHF13 Ubiquitylation K20 -1.737 _(ac)MDSDSCAAAFHPEEYSPSCK(gl)R_
RBL1 Phosphorylation S640 -0.916 -1.810 _DMQPLS(ph)PISVHER_
RBL1 Phosphorylation S749 0.935 1.566 _VKS(ph)PVSLTAHSLIGASPK_
RBL1 Ubiquitylation K885 -0.844 _SVLLK(gl)SIPR_
RBL2 Phosphorylation S639 0.520 _ADEICIAGS(ph)PLTPR_
RBL2 Phosphorylation S662 0.551 0.137 _SITS(ph)PTTLYDR_
RBL2 Phosphorylation S981 -1.828 _SSSTLPVPQPS(ph)SAPPT(ph)PTR_
RBL2 Phosphorylation S982 -2.152 _SSSTLPVPQPSS(ph)APPT(ph)PTR_
RBL2 Phosphorylation T986 -1.219 -1.828 _SSSTLPVPQPSS(ph)APPT(ph)PTR_
RBL2 Phosphorylation S1078 0.241 0.286 _IFYYFS(ph)NSPSK_
RBL2 Phosphorylation S1080 -0.327 -0.297 _IFYYFSNS(ph)PSK_
RBL2 Phosphorylation S1112 -0.598 -0.843 _RGILLEDGSES(ph)PAKR_
RCBTB1 Ubiquitylation K522 1.252 1.343 _EFIAK(gl)ASK_
SETD7 Phosphorylation S3 -0.012 _(ac)MDS(ph)DDEMVEEAVEGHLDDDGLPHGFCTVTYSSTDR_
SMARCAD1 Phosphorylation T54 -0.579 -0.089 _ANT(ph)PDSDITEK_
SMARCAD1 Phosphorylation S79 1.866 0.866 _KAS(ph)ISYFK_
SMARCAD1 Phosphorylation S95 -0.165 _GIQYIDLS(ph)SDSEDVVSPNCSNTVQEK_
SMARCAD1 Phosphorylation S152 1.382 1.569 _RNDDISELEDLS(ph)ELEDLKDAK_
SMARCAD1 Phosphorylation S211 0.248 _KLS(ph)SSSEPYEEDEFNDDQSIKK_
TAF5 Ubiquitylation K318 0.476 0.385 _DSYQLLK(gl)R_
TBL1XR1 Ubiquitylation K102 -0.183 _DK(gl)LAQQQAAAAAAAAAAASQQGSAK_
TDG Ubiquitylation K103 0.728 _ITDTFK(gl)VKR_
TDG Ubiquitylation K105 1.500 _ITDTFKVK(gl)_
TDG Ubiquitylation K201 -0.531 0.797 _TTPGSK(gl)DLSSK(gl)EFR_
TDG Ubiquitylation K206 0.334 1.024 _TTPGSK(gl)DLSSK(gl)EFR_
TDG Ubiquitylation K218 1.203 _ILVQK(gl)LQK_
TDG Ubiquitylation K221 1.524 _LQK(gl)YQPR_
TDG Ubiquitylation K246 0.699 1.949 _EVFGVK(gl)VK_
TDG Ubiquitylation K285 1.047 _AQDK(gl)VHYYIK_
TDG Ubiquitylation K293 1.411 _LK(gl)DLRDQLK_
TDG Ubiquitylation K300 0.980 _DQLK(gl)GIER_
TDRD3 Phosphorylation S256 0.076 _IRS(ph)EDEEDLGNARPSAPSTLFDFLESK_
TET1 Phosphorylation S871 -0.220 _DGS(ph)PVQPSLLSLM(ox)K_
TLK1 Phosphorylation S741 0.299 _RS(ph)NSSGNLHMAGLTASPTPPSSSIITY_
TLK2 Phosphorylation T98 0.262 _ISDYFEFAGGSAPGT(ph)SPGR_
TLK2 Phosphorylation S99 0.267 -0.122 _ISDYFEFAGGSAPGTS(ph)PGR_
UBN1 Phosphorylation S660 -0.661 _ELPSQASGGLANPPPVNLEDS(ph)LDEDLIRNPASSVEAVSK_
UTP3 Phosphorylation S37 -1.053 -0.782 _AGPTLTDENGDDLGLPPS(ph)PGDTSYYQDQVDDFHEAR_
UTP3 Phosphorylation S150 2.057 _GRQS(ph)QQEAEEEEREEEEEAQIIQR_
UTP3 Ubiquitylation K317 0.721 0.064 _LSVVDQK(gl)LSSEIR_
WHSC1 Phosphorylation T49 -1.049 _GIGT(ph)PPNT(ph)TPIK_
WHSC1 Phosphorylation T54 -1.049 _GIGT(ph)PPNTT(ph)PIK_
WHSC1 Phosphorylation T483 -0.839 _RIQDPTEDAEAEDT(ph)PRK_


© Copyright Svejstrup Laboratory 2015