bioLOGIC Data » bioLOGIC CategoryView » bioLOGIC VennView » Experimental Details »

bioLOGIC Category

Results for the Category
positive regulation of sequence-specific DNA binding transcription factor activity
(GO:0051091)

RNAi screen result RNAPII IP (MG132) CSB IP CSB IP (MG132) Chrom. Chrom. (MG132) Ubi /Phospo Ubi /Phospho (MG132)
W

Protein Results:

 Results for post-translational modifications (below)
Gene name MGoogle Score RNAi high RNAi low RNAPII-IP (MG132) CSB-IP CSB-IP (MG132) Chrom. Chrom. (MG132)
TP53BP1 2 -1.490 1.970 -0.161 -0.160 0.174
TP53BP1 2 -1.490 1.970 0.638 0.558
ATF2 2 -1.380 1.800
KDM1A 1 -1.020 1.190 1.814 0.225
KDM1A 1 -1.020 1.190 0.355 0.031 0.593
SMARCB1 1 0.850 -0.060 0.041 -0.003 0.699 0.354 -0.731
SMARCB1 1 0.850 -0.060 0.738 1.594
HMGN3 1 0.310 -0.590 -1.537 -1.454
TRAF2 1 -0.570 0.540
TRAF2 1 -0.570 0.540
HDAC2 1 -2.390 4.970
HDAC2 1 -2.390 4.970 0.187 -0.007 0.825
DVL2 0 -0.050 0.580
ZIC2 0 0.440 -0.440
HIPK2 0 -0.990 0.680
HDAC4 0 1.730 -0.740
LRP6 0 0.210 0.050
TCF3 0 0.270 -0.020
MAVS 0 1.610 -0.380 -1.056 -0.630
EP300 0 -1.210 1.320 -1.089 -1.694 -0.723
UBE2I 0 -0.320 0.480 -0.694 -0.283 0.274
PRKD2 0 0.050 0.170 0.914
PRKD2 0 0.050 0.170
HDAC5 0 -0.830 1.270
SRF 0 0.670 -1.020
TAF12 0 -0.620 -0.070 0.042
SMARCA4 0 -0.810 1.520 0.629 -0.158 0.141 0.337 0.333
FOXA1 0 1.190 -0.010
BEX1 0 1.430 -1.040
ANKRD42 0 0.720 -0.420
AKT1 0 -0.050 0.700
AKT1 0 0.860 -0.040
HMGA2 0 0.340 -0.490
ARID5B 0 0.580 -0.330
JMY 0 1.260 -0.540 0.925
CEBPG 0 -1.150 1.620
PPAP2B 0 -0.750 0.840

PTM Sites:

 Back to Protein Results
Gene name PTM type PTM site UV UV (MG132) Sequence
AKT1 Phosphorylation S124 0.252 0.311 _SGS(ph)PSDNSGAEEMEVSLAKPK_
AKT1 Phosphorylation S126 -0.241 _SGSPS(ph)DNSGAEEM(ox)EVSLAK_
AKT1 Ubiquitylation K301 0.988 _EGIK(gl)DGATMK_
ANKRD42 Ubiquitylation K248 -0.403 _SGVDPSVTDK(gl)R_
ARID5B Phosphorylation S264 0.496 0.623 _RDS(ph)FSGVK_
ATF2 Phosphorylation T71 -1.263 -1.166 _NDSVIVADQTPT(ph)PTR_
ATF2 Phosphorylation S90 2.624 2.389 _NCEEVGLFNELAS(ph)PFENEFKK_
ATF2 Phosphorylation S112 1.025 1.118 _MPLDLS(ph)PLATPIIR_
BEX1 Ubiquitylation K130 -1.968 0.603 _QLMEK(gl)LR_
BEX1 Ubiquitylation K134 -1.057 0.454 _EK(gl)QLSHSLR_
CEBPG Ubiquitylation K98 -0.339 _VNQLK(gl)EENERLEAK_
CEBPG Ubiquitylation K113 0.032 0.273 _LLTK(gl)ELSVLK_
DVL2 Ubiquitylation K343 0.846 -1.366 _DIVHK(gl)PGPIVLTVAK_
EP300 Phosphorylation S1038 -0.672 -0.349 _TEIKEEEDQPSTSATQSS(ph)PAPGQSK_
EP300 Phosphorylation S1726 0.994 0.627 _LGLGLDDESNNQQAAATQS(ph)PGDSRR_
EP300 Phosphorylation S2328 -1.092 0.725 _PQSQPPHSSPS(ph)PR_
FOXA1 Phosphorylation S331 -0.760 -0.866 _TGQLEGAPAPGPAAS(ph)PQTLDHSGATATGGASELK_
HDAC2 Ubiquitylation K50 0.036 _K(gl)MEIYRPHK_
HDAC2 Ubiquitylation K67 -0.467 _ATAEEMTK(gl)YHSDEYIK_
HDAC2 Ubiquitylation K89 0.749 -0.241 _SIRPDNMSEYSK(gl)QMQR_
HDAC2 Ubiquitylation K284 0.749 _GHAK(gl)CVEVVK_
HDAC2 Phosphorylation S394 -0.865 -0.997 _M(ox)LPHAPGVQM(ox)QAIPEDAVHEDS(ph)GDEDGEDPDKR_
HDAC2 Phosphorylation S422 0.482 0.781 _IACDEEFS(ph)DSEDEGEGGR_
HDAC4 Phosphorylation S265 -0.390 _RS(ph)SPLLR_
HDAC4 Phosphorylation S266 -0.821 -0.598 _RSS(ph)PLLR_
HDAC4 Phosphorylation S632 -1.146 -0.837 _AQS(ph)SPASATFPVSVQEPPTKPR_
HDAC5 Phosphorylation S265 -0.390 _RS(ph)SPLLR_
HDAC5 Phosphorylation S266 -0.821 -0.598 _RSS(ph)PLLR_
HIPK2 Ubiquitylation K492 -0.060 _YISQTQGLPAEYLLSAGTK(gl)TTR_
HIPK2 Ubiquitylation K614 -0.350 _SCFQNMEICK(gl)R_
HMGA2 Phosphorylation S44 -0.564 -0.762 _KQQQEPTGEPS(ph)PK_
HMGA2 Phosphorylation S105 -0.055 -0.046 _KPAQEETEETSSQES(ph)AEED_
HMGN3 Phosphorylation T10 -0.157 _RKSPENT(ph)EGK_
HMGN3 Phosphorylation S31 -1.777 -1.714 _LS(ph)AKPAPPKPEPK_
HMGN3 Ubiquitylation K33 -1.736 _LSAK(gl)PAPPKPEPKPR_
HMGN3 Phosphorylation S78 3.475 _EGTAPS(ph)ENGETKAEEAQK_
HMGN3 Phosphorylation S93 0.325 0.602 _AEEAQKTES(ph)VDNEGE_
JMY Phosphorylation S115 0.344 _SSAWAEGGS(ph)PR_
JMY Phosphorylation S713 -0.151 -0.126 _GAAS(ph)PVLQEDHCDSLPSVLQVEEK_
JMY Phosphorylation S971 -0.306 _IKEAS(ph)PESEDEEEALPCTDWEN_
JMY Phosphorylation S974 -0.581 _IKEASPES(ph)EDEEEALPCTDWEN_
KDM1A Phosphorylation S69 -2.048 -2.645 _KEPPRAS(ph)PPGGLAEPPGSAGPQAGPTVVPGSATPMETGIAETPEGR_
KDM1A Phosphorylation T88 -1.832 _KEPPRASPPGGLAEPPGSAGPQAGPT(ph)VVPGSATPM(ox)ETGIAETPEGR_
KDM1A Phosphorylation S126 0.780 0.501 _EMDES(ph)LANLSEDEYYS(ph)EEER_
KDM1A Phosphorylation S131 0.204 0.473 _EM(ox)DESLANLS(ph)EDEYYS(ph)EEER_
KDM1A Phosphorylation S137 0.122 0.511 _EM(ox)DESLANLS(ph)EDEYYS(ph)EEER_
KDM1A Phosphorylation S166 -2.328 -2.624 _KLPPPPPQAPPEEENES(ph)EPEEPSGVEGAAFQSR_
KDM1A Ubiquitylation K296 -0.820 _IKPLPTK(gl)K_
KDM1A Ubiquitylation K297 -0.820 _IKPLPTK(gl)K_
KDM1A Ubiquitylation K507 -1.073 _DITAEFLVKSK(gl)_
LRP6 Ubiquitylation K1443 -0.221 _GK(gl)SMISSLSIMGGSSGPPYDR_
MAVS Phosphorylation S152 0.146 -0.466 _EKEPSYPMPVQETQAPES(ph)PGENSEQALQTLSPR_
MAVS Phosphorylation S165 -0.888 _EKEPSYPMPVQETQAPESPGENSEQALQTLS(ph)PR_
MAVS Phosphorylation S222 1.349 1.006 _GPVS(ph)PSVSFQPLAR_
MAVS Ubiquitylation K362 0.082 _AGMVPSK(gl)VPTSMVLTK_
PPAP2B Ubiquitylation K5 0.619 0.462 _(ac)MQNYK(gl)YDK_
PPAP2B Ubiquitylation K8 0.265 0.647 _YDK(gl)AIVPESK_
PPAP2B Ubiquitylation K15 -0.741 -0.668 _AIVPESK(gl)NGGSPALNNNPR_
PRKD2 Phosphorylation S197 0.239 0.895 _RLS(ph)STSLASGHSVR_
PRKD2 Phosphorylation T211 -0.119 _LGT(ph)SESLPCTAEELSR_
PRKD2 Phosphorylation S212 0.113 _LGTS(ph)ESLPCTAEELSR_
PRKD2 Phosphorylation S214 0.216 0.302 _LGTSES(ph)LPCTAEELSR_
PRKD2 Phosphorylation S710 -0.413 -0.511 _S(ph)VVGTPAYLAPEVLLNQGYNR_
PRKD2 Phosphorylation T714 -0.279 _S(ph)VVGTPAYLAPEVLLNQGYNR_
PRKD2 Ubiquitylation K730 1.177 _IIGEK(gl)SFR_
PRKD2 Phosphorylation S886 -0.718 -0.305 _DLGGACPPQDHDMQGLAERIS(ph)VL_
SMARCA4 Ubiquitylation K357 -0.934 _ITPIQK(gl)PR_
SMARCA4 Ubiquitylation K405 0.109 1.148 _ATIELK(gl)ALR_
SMARCA4 Ubiquitylation K437 -0.317 _DTALETALNAK(gl)AYKR_
SMARCA4 Ubiquitylation K455 0.225 _ITEK(gl)LEK_
SMARCA4 Ubiquitylation K496 0.923 _SVTGK(gl)IQK_
SMARCA4 Phosphorylation S677 -0.880 -0.324 _KAENAEGQTPAIGPDGEPLDETSQMS(ph)DLPVK_
SMARCA4 Ubiquitylation K1283 0.125 _ILAAAK(gl)YK_
SMARCA4 Phosphorylation S1413 -0.265 0.515 _EVDYSDS(ph)LTEK_
SMARCA4 Phosphorylation S1486 -0.713 -0.935 _LS(ph)PNPPNLTK_
SMARCB1 Ubiquitylation K13 0.411 -0.949 _TFGQK(gl)PVK_
SMARCB1 Ubiquitylation K208 -0.170 _LDMEIDGQK(gl)LR_
SRF Phosphorylation S224 -0.512 -0.458 _ALIQTCLNSPDS(ph)PPR_
TAF12 Phosphorylation S51 0.073 -0.035 _LS(ph)PENNQVLTK_
TCF3 Phosphorylation S328 0.865 0.756 _AGAPGALS(ph)PSYDGGLHGLQSK_
TP53BP1 Phosphorylation S119 2.253 2.083 _TSS(ph)VLGMSVESAPAVEEEKGEELEQK_
TP53BP1 Phosphorylation S265 0.355 0.274 _SEDM(ox)PFS(ph)PK_
TP53BP1 Phosphorylation S280 -0.705 _EQLS(ph)AQELMESGLQIQKSPEPEVLSTQEDLFDQSNK_
TP53BP1 Phosphorylation S287 -1.294 -1.483 _EQLSAQELMES(ph)GLQIQKSPEPEVLSTQEDLFDQSNK_
TP53BP1 Phosphorylation S294 -1.218 -0.875 _S(ph)PEPEVLSTQEDLFDQSNK_
TP53BP1 Phosphorylation S379 -0.210 _STPFIVPS(ph)SPTEQEGR_
TP53BP1 Phosphorylation S380 -0.036 -0.182 _STPFIVPSS(ph)PTEQEGR_
TP53BP1 Phosphorylation T382 -0.167 _STPFIVPSSPT(ph)EQEGR_
TP53BP1 Phosphorylation S500 0.214 0.591 _NS(ph)PEDLGLSLTGDSCK_
TP53BP1 Phosphorylation S525 -0.547 _LM(ox)LSTSEYSQS(ph)PK_
TP53BP1 Phosphorylation S552 0.102 0.080 _IDEDGENTQIEDTEPMS(ph)PVLNSK_
TP53BP1 Phosphorylation S580 1.645 1.855 _FVPAENDSILMNPAQDGEVQLS(ph)QNDDKTK_
TP53BP1 Phosphorylation S771 0.885 _VDVS(ph)CEPLEGVEK_
TP53BP1 Phosphorylation S831 2.288 2.726 _SGTAETEPVEQDSS(ph)QPSLPLVR_
TP53BP1 Phosphorylation T922 1.634 _EGDIIPPLTGAT(ph)PPLIGHLK_
TP53BP1 Phosphorylation S993 2.280 _LVS(ph)PETEASEESLQFNLEKPATGER_
TP53BP1 Phosphorylation S1028 0.901 0.869 _NGSTAVAESVAS(ph)PQK_
TP53BP1 Phosphorylation T1055 1.132 0.932 _SEDPPT(ph)TPIR_
TP53BP1 Phosphorylation T1056 0.818 0.172 _SEDPPTT(ph)PIR_
TP53BP1 Phosphorylation S1067 3.036 2.786 _GNLLHFPS(ph)SQGEEEKEK_
TP53BP1 Phosphorylation S1068 2.467 3.424 _GNLLHFPSS(ph)QGEEEKEKLEGDHTIR_
TP53BP1 Phosphorylation S1094 -1.038 _QSQQPMKPIS(ph)PVKDPVS(ph)PASQK_
TP53BP1 Phosphorylation S1101 -1.038 _QSQQPMKPIS(ph)PVKDPVS(ph)PASQK_
TP53BP1 Phosphorylation S1113 0.104 0.162 _MVIQGPS(ph)SPQGEAMVTDVLEDQK_
TP53BP1 Phosphorylation S1114 0.438 0.116 _M(ox)VIQGPSS(ph)PQGEAM(ox)VTDVLEDQK_
TP53BP1 Phosphorylation S1317 1.156 1.461 _TSS(ph)GTSLSAMHSSGSSGK_
TP53BP1 Phosphorylation S1362 0.462 0.439 _GGPGKLS(ph)PR_
TP53BP1 Phosphorylation S1426 -0.275 0.340 _ETAVPGPLGIEDIS(ph)PNLSPDDK_
TP53BP1 Phosphorylation S1430 -0.558 -0.362 _ETAVPGPLGIEDISPNLS(ph)PDDK_
TP53BP1 Phosphorylation S1460 -0.626 -0.602 _RS(ph)DSPEIPFQAAAGPSDGLDASSPGNSFVGLR_
TP53BP1 Phosphorylation S1462 -1.029 -0.981 _RSDS(ph)PEIPFQAAAGPSDGLDASSPGNSFVGLR_
TP53BP1 Phosphorylation S1618 -0.090 _AADIS(ph)LDNLVEGK_
TP53BP1 Phosphorylation S1673 -0.238 -0.008 _LITS(ph)EEERS(ph)PAK_
TP53BP1 Phosphorylation S1678 -0.242 -0.396 _LITSEEERS(ph)PAK_
TRAF2 Phosphorylation T7 -0.822 -1.190 _(ac)AAASVT(ph)PPGSLELLQPGFSK_
TRAF2 Ubiquitylation K27 -0.253 2.194 _TLLGTK(gl)LEAK_
TRAF2 Ubiquitylation K119 0.519 _GTLK(gl)EYESCHEGR_
TRAF2 Ubiquitylation K176 -1.233 1.022 _APCCGADVK(gl)AHHEVCPK_
TRAF2 Ubiquitylation K207 0.147 0.918 _FQDHVK(gl)TCGK_
TRAF2 Ubiquitylation K481 -0.507 0.417 _MEAK(gl)NSYVR_
UBE2I Ubiquitylation K49 0.535 _K(gl)GTPWEGGLFK_
UBE2I Ubiquitylation K59 0.481 _GTPWEGGLFK(gl)LR_
ZIC2 Ubiquitylation K253 -0.697 0.374 _QQCIK(gl)QELICK_


.

© Copyright Svejstrup Laboratory 2015