bioLOGIC Data » bioLOGIC CategoryView » bioLOGIC VennView » Experimental Details »

bioLOGIC Data

bioLOGIC Data


Exact search


Query: MAVS

RNAi screen result RNAPII IP (PI) CSB IP CSB IP (PI) Chrom. Chrom. (PI) Phosphorylation Ubiquitylation
W
[Click on the plots to view the data selection in the respective scatterplot]

Protein Results:

 Results for post-translational modifications: see below | Red/green: hit at lower/upper end of the respective screen
Gene name Point score Z-score sums RNAi high RNAi low RNAPII-IP (PI) CSB-IP CSB-IP (PI) Chrom. Chrom. (PI)
MAVS 0 0.751 1.610 -0.380 -1.056 -0.630

PTM Sites:

 Back to Protein Results | Red/green: hit at lower/upper end of the respective screen
Gene name PTM type PTM site UV UV (PI) Sequence
MAVS Phosphorylation S222 1.349 1.006 _GPVS(ph)PSVSFQPLAR_
MAVS Phosphorylation S152 0.146 -0.466 _EKEPSYPMPVQETQAPES(ph)PGENSEQALQTLSPR_
MAVS Phosphorylation S165 -0.888 _EKEPSYPMPVQETQAPESPGENSEQALQTLS(ph)PR_
MAVS Ubiquitylation K362 0.082 _AGMVPSK(gl)VPTSMVLTK_

Background Information for MAVS:


Pubmed-MAVS »
Uniprot-MAVS »
Biogrid-MAVS »
ProteomicsDB-MAVS »

Tumorportal-MAVS »
COSMIC-MAVS »
GenomeRNAi-MAVS »
Genecards-MAVS


Protein-protein Interactions for MAVS
Show screen data for Category Name and Description Link to cat description Data Source
Category members IP bait BZW2 Cat. description BioPlex, Huttlin, Gygi, Cell 2015
Category members IP bait DHRS9 Cat. description BioPlex, Huttlin, Gygi, Cell 2015
Category members IP bait HSPA8 Cat. description BioPlex, Huttlin, Gygi, Cell 2015
Category members IP bait HSPA9 Cat. description BioPlex, Huttlin, Gygi, Cell 2015
Category members IP bait KPTN Cat. description BioPlex, Huttlin, Gygi, Cell 2015
Category members IP bait PLK1 Cat. description BioPlex, Huttlin, Gygi, Cell 2015
Category members IP bait PSMC3 Cat. description BioPlex, Huttlin, Gygi, Cell 2015
Category members IP bait RAB6B Cat. description BioPlex, Huttlin, Gygi, Cell 2015
Category members IP bait SLC39A12 Cat. description BioPlex, Huttlin, Gygi, Cell 2015
Category members IP bait SLC7A1 Cat. description BioPlex, Huttlin, Gygi, Cell 2015
Category members IP bait SOD1 Cat. description BioPlex, Huttlin, Gygi, Cell 2015
Category members IP bait SPPL2B Cat. description BioPlex, Huttlin, Gygi, Cell 2015
Category members IP bait TLR1 Cat. description BioPlex, Huttlin, Gygi, Cell 2015
Category members IP bait VAC14 Cat. description BioPlex, Huttlin, Gygi, Cell 2015
Category members IP bait VIPR2 Cat. description BioPlex, Huttlin, Gygi, Cell 2015


Protein Domains in MAVS
Domain name Domain Description TC-NER relevance -log10(p-value)


Protein complexes (CORUM database) featuring MAVS
Category Type Category ID Category Name Data Source TC-NER relevance -log10(p-value)


Categories featuring MAVS
Category Type Category ID Category Name Data Source TC-NER relevance -log10(p-value)
Category members GO Category GO:0005515 protein binding Database INF
Category members GO Category GO:0019048 modulation by virus of host morphology or physiology Database 7.81
Category members GO Category GO:0016021 integral to membrane Database 7.67
Category members Pathway Pathway_458 REACTOME_IMMUNE_SYSTEM 0 3
Category members GO Category GO:0005739 mitochondrion Database 1.67
Category members GO Category GO:0032481 positive regulation of type I interferon production Database 0.54
Category members GO Category GO:0005741 mitochondrial outer membrane Database 0.46
Category members GO Category GO:0019901 protein kinase binding Database 0.37
Category members Pathway Pathway_460 REACTOME_INNATE_IMMUNE_SYSTEM 0 0.29
Category members GO Category GO:0001934 positive regulation of protein phosphorylation Database 0.22
Category members GO Category GO:0050700 CARD domain binding Database 0.21
Category members GO Category GO:0045944 positive regulation of transcription from RNA polymerase II promoter Database 0.13
Category members GO Category GO:0051607 defense response to virus Database 0.07
Category members GO Category GO:0042742 defense response to bacterium Database 0.06
Category members Pathway Pathway_484 REACTOME_RIG_I_MDA5_MEDIATED_INDUCTION_OF_IFN_ALPHA_BETA_PATHWAYS 0 0.06
Category members GO Category GO:0045087 innate immune response Database 0.05
Category members Pathway Pathway_1226 REACTOME_TRAF3_DEPENDENT_IRF_ACTIVATION_PATHWAY 0 0.05
Category members GO Category GO:0033160 positive regulation of protein import into nucleus, translocation Database 0.04
Category members GO Category GO:0039529 RIG-I signaling pathway Database 0.01
Category members GO Category GO:0005778 peroxisomal membrane Database 0.01
Category members Pathway Pathway_1042 REACTOME_NFKB_ACTIVATION_THROUGH_FADD_RIP1_PATHWAY_MEDIATED_BY_CASPASE_8_AND10 0 0
Category members Pathway Pathway_1165 REACTOME_TRAF6_MEDIATED_IRF7_ACTIVATION 0 0
Category members Pathway Pathway_354 KEGG_CYTOSOLIC_DNA_SENSING_PATHWAY 0 0
Category members Pathway Pathway_483 KEGG_RIG_I_LIKE_RECEPTOR_SIGNALING_PATHWAY 0 0
Category members Pathway Pathway_785 REACTOME_NEGATIVE_REGULATORS_OF_RIG_I_MDA5_SIGNALING 0 0
Category members Pathway Pathway_954 REACTOME_TRAF6_MEDIATED_NFKB_ACTIVATION 0 0
Category members GO Category GO:0002218 activation of innate immune response Database 0
Category members GO Category GO:0002230 positive regulation of defense response to virus by host Database 0
Category members GO Category GO:0004871 signal transducer activity Database 0
Category members GO Category GO:0005777 peroxisome Database 0
Category members GO Category GO:0007165 signal transduction Database 0
Category members GO Category GO:0031966 mitochondrial membrane Database 0
Category members GO Category GO:0032480 negative regulation of type I interferon production Database 0
Category members GO Category GO:0032727 positive regulation of interferon-alpha production Database 0
Category members GO Category GO:0032728 positive regulation of interferon-beta production Database 0
Category members GO Category GO:0032757 positive regulation of interleukin-8 production Database 0
Category members GO Category GO:0032760 positive regulation of tumor necrosis factor production Database 0
Category members GO Category GO:0042993 positive regulation of transcription factor import into nucleus Database 0
Category members GO Category GO:0043123 positive regulation of I-kappaB kinase/NF-kappaB signaling Database 0
Category members GO Category GO:0045071 negative regulation of viral genome replication Database 0
Category members GO Category GO:0051091 positive regulation of sequence-specific DNA binding transcription factor activity Database 0
Category members GO Category GO:0060340 positive regulation of type I interferon-mediated signaling pathway Database 0
Category members GO Category GO:0071360 cellular response to exogenous dsRNA Database 0


.

© Copyright Svejstrup Laboratory 2015