bioLOGIC Data » bioLOGIC CategoryView » bioLOGIC VennView » Experimental Details »
bioLOGIC Category

Results for the Category
RIG-I signaling pathway
(GO:0039529)

RNAi screen result RNAPII IP (MG132) CSB IP CSB IP (MG132) Chrom. Chrom. (MG132) Ubi /Phospo Ubi /Phospho (MG132)
W

Protein Results:

Results for post-translational modifications (below)
Gene name MGoogle Score RNAi high RNAi low RNAPII-IP (MG132) CSB-IP CSB-IP (MG132) Chrom. Chrom. (MG132)
MAVS 0 1.610 -0.380 -1.056 -0.630

PTM Sites:

Back to Protein Results
Gene name PTM type PTM site UV UV (MG132) Sequence
MAVS Phosphorylation S152 0.146 -0.466 _EKEPSYPMPVQETQAPES(ph)PGENSEQALQTLSPR_
MAVS Phosphorylation S165 -0.888 _EKEPSYPMPVQETQAPESPGENSEQALQTLS(ph)PR_
MAVS Phosphorylation S222 1.349 1.006 _GPVS(ph)PSVSFQPLAR_
MAVS Ubiquitylation K362 0.082 _AGMVPSK(gl)VPTSMVLTK_


© Copyright Svejstrup Laboratory 2015