bioLOGIC Data » bioLOGIC CategoryView » bioLOGIC VennView » Experimental Details »
bioLOGIC Category

Results for the Category
positive regulation of defense response to virus by host
(GO:0002230)

RNAi screen result RNAPII IP (MG132) CSB IP CSB IP (MG132) Chrom. Chrom. (MG132) Ubi /Phospo Ubi /Phospho (MG132)
W

Protein Results:

Results for post-translational modifications (below)
Gene name MGoogle Score RNAi high RNAi low RNAPII-IP (MG132) CSB-IP CSB-IP (MG132) Chrom. Chrom. (MG132)
PML 1 -0.420 0.350 -0.244 0.322
MAVS 0 1.610 -0.380 -1.056 -0.630
CREB3 0 0.180 -0.820
APOBEC3F 0 -0.400 0.970 -0.141 0.306 1.390 0.929
SIN3A 0 -0.610 0.780 0.378 -0.208 0.304 -0.168 0.410
TMEM173 0 -0.800 0.340

PTM Sites:

Back to Protein Results
Gene name PTM type PTM site UV UV (MG132) Sequence
APOBEC3F Ubiquitylation K197 0.530 _GLK(gl)TNFR_
CREB3 Ubiquitylation K176 -0.114 _TEEQILK(gl)R_
MAVS Phosphorylation S152 0.146 -0.466 _EKEPSYPMPVQETQAPES(ph)PGENSEQALQTLSPR_
MAVS Phosphorylation S165 -0.888 _EKEPSYPMPVQETQAPESPGENSEQALQTLS(ph)PR_
MAVS Phosphorylation S222 1.349 1.006 _GPVS(ph)PSVSFQPLAR_
MAVS Ubiquitylation K362 0.082 _AGMVPSK(gl)VPTSMVLTK_
PML Ubiquitylation K394 0.515 0.360 _LQDLSSCITQGK(gl)DAAVSKK_
PML Phosphorylation S403 3.141 _KAS(ph)PEAASTPRDPIDVDLPEEAER_
PML Ubiquitylation K476 -0.403 -0.735 _GPSYGEDVSNTTTAQK(gl)R_
PML Phosphorylation S504 -0.198 -0.109 _S(ph)SPEQPRPSTSK_
PML Phosphorylation S505 -0.198 -0.109 _S(ph)SPEQPRPSTSK_
PML Phosphorylation S518 -1.632 -1.605 _AVS(ph)PPHLDGPPS(ph)PR_
PML Phosphorylation S527 -1.392 -1.605 _AVS(ph)PPHLDGPPS(ph)PR_
PML Phosphorylation S530 0.466 0.093 _S(ph)PVIGSEVFLPNSNHVASGAGEAEER_
PML Ubiquitylation K623 -0.784 _IDNETQK(gl)ISQLAAVNR_
SIN3A Ubiquitylation K155 0.182 _EFK(gl)SQSIDTPGVISR_
SIN3A Phosphorylation T266 -0.572 _VSKPSQLQAHTPASQQT(ph)PPLPPYASPR_
SIN3A Phosphorylation S277 -1.598 _S(ph)PPVQPHTPVTISLGTAPSLQNNQPVEFNHAINYVNK_
SIN3A Phosphorylation S295 -1.959 _SPPVQPHTPVTISLGTAPS(ph)LQNNQPVEFNHAINYVNK_
SIN3A Ubiquitylation K638 -0.223 _VLEAIQK(gl)K_
SIN3A Ubiquitylation K639 -0.223 _VLEAIQK(gl)K_
SIN3A Ubiquitylation K715 1.012 _GFNK(gl)VWR_
SIN3A Phosphorylation S832 0.764 0.363 _GDLS(ph)DVEEEEEEEM(ox)DVDEATGAVKK_
SIN3A Ubiquitylation K875 0.131 0.003 _LLFSNTAAQK(gl)LR_
SIN3A Ubiquitylation K937 -0.224 -0.025 _DK(gl)SDSPAIQLR_
SIN3A Phosphorylation S940 -0.107 _DKSDS(ph)PAIQLR_
SIN3A Phosphorylation T1111 0.691 0.517 _YM(ox)NSDTT(ph)SPELR_
SIN3A Phosphorylation S1112 0.623 0.725 _YM(ox)NSDTTS(ph)PELR_
TMEM173 Ubiquitylation K289 0.324 _EDRLEQAK(gl)LFCR_
TMEM173 Phosphorylation S358 0.609 _TSAVPSTSTMS(ph)QEPELLISGMEKPLPLR_


© Copyright Svejstrup Laboratory 2015