Results for the Category
negative regulation of erythrocyte differentiation
(GO:0045647)
| RNAi screen result | RNAPII IP (MG132) | CSB IP | CSB IP (MG132) | Chrom. | Chrom. (MG132) | Ubi /Phospo | Ubi /Phospho (MG132) |
| W | |||||||
| Gene name | MGoogle Score | RNAi high | RNAi low | RNAPII-IP (MG132) | CSB-IP | CSB-IP (MG132) | Chrom. | Chrom. (MG132) |
|---|---|---|---|---|---|---|---|---|
| HOXA5 | 0 | 0.030 | -0.190 | -0.887 | ||||
| STAT5B | 0 | 0.670 | -0.960 | |||||
| LDB1 | 0 | 0.670 | -0.650 | -1.168 |
| Gene name | PTM type | PTM site | UV | UV (MG132) | Sequence |
|---|---|---|---|---|---|
| LDB1 | Ubiquitylation | K76 | -0.052 | _IFELNK(gl)R_ | |
| LDB1 | Ubiquitylation | K271 | -0.154 | _DCLK(gl)TCLFQK_ | |
| LDB1 | Ubiquitylation | K277 | -1.611 | -0.630 | _TCLFQK(gl)WQR_ |
| LDB1 | Phosphorylation | S323 | -0.402 | -0.031 | _KS(ph)PASTFALSSQVPDVMVVGEPTLMGGEFGDEDER_ |
| STAT5B | Phosphorylation | S194 | 0.270 | _IQAQFGPLAQLS(ph)PQER_ |
.
© Copyright Svejstrup Laboratory 2015