bioLOGIC Data » bioLOGIC CategoryView » bioLOGIC VennView » Experimental Details »

bioLOGIC Category

Results for the Category
cell-cell junction
(GO:0005911)

RNAi screen result RNAPII IP (MG132) CSB IP CSB IP (MG132) Chrom. Chrom. (MG132) Ubi /Phospo Ubi /Phospho (MG132)
W

Protein Results:

 Results for post-translational modifications (below)
Gene name MGoogle Score RNAi high RNAi low RNAPII-IP (MG132) CSB-IP CSB-IP (MG132) Chrom. Chrom. (MG132)
PARD3 3 -1.810 4.070 0.910
PARD3 3 -1.810 4.070
PARD3 3 -1.810 4.070 0.184 0.180
EPB41L3 2 -0.180 -0.240 0.686 -0.304 -0.569 0.493 0.521
EPB41L3 2 -0.180 -0.240 1.511 -0.048 0.066 -0.014
EPB41L3 2 -0.180 -0.240
EPB41L3 2 -0.180 -0.240
DLG3 2 0.180 -1.120 1.552 0.102 0.488
DLG3 2 0.180 -1.120
PNN 2 -1.000 1.720 0.697 0.186 0.165 -0.089 -0.064
TJP1 2 -0.410 1.150
TJP1 2 -0.410 1.150 -0.039 -0.011
TJP1 2 -0.410 1.150
ACTN4 2 -0.050 0.190 0.936 1.929 -1.407 0.572 0.293
VCL 1 0.570 -0.620 2.233 0.870
CTNNA1 1 -0.520 1.660 -0.690 -1.164
CTNNA1 1 -0.520 1.660 0.139 0.436 0.323
DLG1 1 0.400 -0.220 1.552 0.102 0.488
DBN1 1 0.400 -0.880 0.526 -0.073 -0.164 0.632 0.196
TLN1 1 -0.130 0.000 0.807 0.246 0.137
PKP4 1 -0.200 1.770 1.061 0.147
CASK 1 2.050 -1.110
CASK 1 2.050 -1.110 -0.162 -0.217 -0.918 0.048 0.372
TWF1 1 0.880 -0.820 0.384
CXADR 1 -0.550 1.230 0.333 1.691
ILK 1 -1.560 3.680 -0.463 -0.527
CADM1 1 -0.550 0.210 1.891 -0.186 0.114
CDH1 0 0.150 0.280 -0.623
DSG2 0 0.200 0.000 0.827 -0.456 -0.256
SDCCAG8 0 0.350 -0.490
PKP2 0 0.120 0.970 0.814 0.742
PKP2 0 0.120 0.970
PTPRU 0 0.620 0.040
PRKCZ 0 -0.290 0.310
MAGI3 0 1.510 -0.840
MAGI3 0 1.510 -0.840 0.696 0.967
FAT1 0 -0.370 0.210
DSP 0 -0.660 1.420 -2.938 -0.696 -0.240
CSK 0 1.200 -0.960 -1.211
CSK 0 1.200 -0.960
LIN7B 0 0.200 0.140 0.413 0.576 0.542
RAPGEF2 0 -0.860 1.560
PTK7 0 -0.240 0.340 -0.232 0.174
ECT2 0 0.620 -0.960 -0.787
SLC2A1 0 0.090 -0.210 -0.169 -0.253
MAP2K2 0 -0.610 0.080
MAP2K2 0 -0.610 0.080
RAP1B 0 -0.520 0.540 -0.200 0.374 0.556
AJUBA 0 -0.310 0.400
PVRL2 0 -0.940 1.620 0.748 -0.029
MLLT4 0 -1.080 1.480
MLLT4 0 -1.080 1.480 -1.880 -0.065
MLLT4 0 -1.080 1.480 0.689 0.492
DSG1 0 1.050 -0.690 -4.325
DSC3 0 1.100 -0.870 -4.398 -2.576
IQGAP1 0 -0.420 0.300 0.641 -0.402
IQGAP1 0 -0.420 0.300 1.363 0.406 0.007
RAB10 0 -0.280 -0.200 1.641 -1.484 0.560 0.491
CDC42BPA 0 0.270 -0.540 0.369 0.295
SHROOM2 0 1.900 -1.500
ADD3 0 -1.290 1.910 0.268 -0.377 0.481 1.104
LIN7C 0 0.413 0.576 0.542
LIN7C 0
PAK1 0 1.190 -0.630
ITGB1 0 0.390 -0.650 0.101 -0.036
MAGI1 0 -0.840 1.740 0.696 0.967
ADAM17 0 0.520 -0.620
TIAM1 0 -0.620 0.220
PCDH1 0 1.500 -0.450
F11R 0 -0.710 0.530 0.514 0.505
ITGA5 0 0.320 -0.520 0.858 0.617
CADM3 0 0.010 -0.310
VANGL2 0 -1.030 1.450
PRKCD 0 0.250 0.070 0.578 0.427
KIAA1462 0 1.210 -0.380 0.670
JAM3 0 0.860 -0.200 0.644 0.464
CTNNB1 0 0.490 -0.230
CTNNB1 0 0.490 -0.230 -0.415 0.628 0.215
CLIC4 0 -0.105
CDH2 0 -0.110 -0.060 -1.092 -0.918
TLN2 0 -0.680 1.130
KIRREL 0 -1.390 1.250
IQGAP3 0 1.720 -1.070 0.165 0.274
PRKD1 0 1.050 0.130
PRKD1 0 1.050 0.130
PRKD1 0 1.050 0.130
PKP3 0 1.260 -0.810 0.737 0.350
OCLN 0 1.360 -0.180 0.052 0.302
OCLN 0 1.360 -0.180
CTNND1 0 -0.610 1.090
CTNND1 0 -0.610 1.090 0.656 0.248 0.133 0.350
LDB1 0 0.670 -0.650 -1.168
CDC42BPB 0 -1.290 1.790 0.546 0.645 0.683

PTM Sites:

 Back to Protein Results
Gene name PTM type PTM site UV UV (MG132) Sequence
ACTN4 Ubiquitylation K125 1.906 _ALDFIASKGVK(gl)_
ACTN4 Ubiquitylation K350 0.585 _VQEK(gl)CQLEINFNTLQTK_
ACTN4 Ubiquitylation K417 0.789 _LDHLAEK(gl)FR_
ACTN4 Ubiquitylation K592 -0.644 0.678 _EAILAIHK(gl)EAQR_
ACTN4 Ubiquitylation K760 0.273 1.507 _DAK(gl)GISQEQMQEFR_
ADAM17 Phosphorylation S791 -0.594 0.152 _S(ph)FEDLTDHPVTR_
ADD3 Phosphorylation T11 -1.070 _(ac)SSDASQGVIT(ph)TPPPPSM(ox)PHK_
ADD3 Phosphorylation T12 -0.760 -0.484 _(ac)SSDASQGVITT(ph)PPPPSMPHK_
ADD3 Ubiquitylation K21 -0.862 _(ac)SSDASQGVITTPPPPSMPHK(gl)ER_
ADD3 Phosphorylation S42 0.088 _NMS(ph)PDLRQDFNMMEQR_
ADD3 Phosphorylation S64 0.379 _VTQILQS(ph)PAFREDLECLIQEQMK_
ADD3 Ubiquitylation K280 -0.136 0.353 _IQLQK(gl)VLGPSCK_
ADD3 Phosphorylation S423 -0.556 -0.594 _SDVEIPATVTAFSFEDDTVPLS(ph)PLK_
ADD3 Phosphorylation S442 -1.117 _WLNS(ph)PNTYMK_
ADD3 Phosphorylation S478 -2.024 _VS(ph)GGTPIKIEDPNQFVPLNTNPNEVLEK_
ADD3 Phosphorylation T481 -2.024 _VS(ph)GGTPIKIEDPNQFVPLNTNPNEVLEK_
ADD3 Phosphorylation S673 -0.046 _IEEVLS(ph)PEGSPSKSPSK_
ADD3 Phosphorylation S677 0.077 -0.026 _IEEVLSPEGS(ph)PSKS(ph)PSK_
ADD3 Phosphorylation S679 -0.270 -0.195 _SPEKIEEVLSPEGSPS(ph)KSPSK_
ADD3 Phosphorylation S681 0.027 0.143 _IEEVLSPEGSPSKS(ph)PSK_
ADD3 Phosphorylation S683 0.203 -0.184 _IEEVLSPEGSPSKSPS(ph)K_
AJUBA Phosphorylation S119 0.930 _LEPTAPALS(ph)PR_
CADM3 Phosphorylation S192 -0.857 -0.995 _TFTVSS(ph)SVT(ph)FQVTR_
CADM3 Phosphorylation T195 -0.857 -0.995 _TFTVSS(ph)SVT(ph)FQVTR_
CASK Ubiquitylation K41 1.029 1.231 _ETGQQFAVK(gl)IVDVAK_
CASK Ubiquitylation K60 0.240 0.541 _FTSSPGLSTEDLK(gl)R_
CASK Phosphorylation S570 0.125 _TQSS(ph)SCEDLPSTTQPK_
CASK Phosphorylation S571 0.134 -0.032 _TQSSS(ph)CEDLPSTTQPK_
CASK Ubiquitylation K665 -0.631 _LENSK(gl)NGTAGLIPSPELQEWR_
CASK Ubiquitylation K691 1.108 _TK(gl)QEQQASCTWFGK_
CASK Ubiquitylation K703 0.627 _TKQEQQASCTWFGK(gl)K_
CASK Ubiquitylation K704 0.627 _TKQEQQASCTWFGK(gl)K_
CDC42BPA Phosphorylation S1545 0.686 _RYS(ph)FRVPEEER_
CDC42BPA Phosphorylation S1629 0.643 0.973 _SMS(ph)ASSGLSAR_
CDC42BPA Phosphorylation S1651 0.478 0.828 _EFS(ph)GGSYSAK_
CDC42BPA Phosphorylation S1721 1.103 1.216 _SLS(ph)LESTDR_
CDC42BPB Ubiquitylation K338 -0.347 _LGQNGIEDFKK(gl)_
CDC42BPB Ubiquitylation K426 0.566 _SIMQSNTLTK(gl)DEDVQR_
CDC42BPB Phosphorylation S481 0.701 0.480 _ALSNS(ph)NRDKEIK_
CDC42BPB Ubiquitylation K1337 1.400 1.105 _GCQLMATATLK(gl)R_
CDC42BPB Phosphorylation S1690 -1.711 -2.133 _HSTPSNSSNPSGPPS(ph)PNSPHR_
CLIC4 Ubiquitylation K106 -0.220 0.166 _YLK(gl)LSPK_
CLIC4 Ubiquitylation K146 -0.028 0.596 _GLLK(gl)TLQK_
CLIC4 Ubiquitylation K199 0.892 0.090 _LHIVK(gl)VVAK_
CLIC4 Ubiquitylation K249 -0.463 _DEFTNTCPSDKEVEIAYSDVAK(gl)R_
CSK Ubiquitylation K196 -0.133 _SGWALNMKELK(gl)_
CTNNA1 Ubiquitylation K16 -0.194 -0.141 _WDPK(gl)SLEIR_
CTNNA1 Ubiquitylation K45 -1.131 -0.728 _LLEPLVTQVTTLVNTNSK(gl)GPSNK_
CTNNA1 Ubiquitylation K120 -0.333 _AAAGEFADDPCSSVK(gl)R_
CTNNA1 Ubiquitylation K414 0.977 _NGNEK(gl)EVKEYAQVFR_
CTNNA1 Ubiquitylation K417 0.211 _NGNEK(gl)EVKEYAQVFR_
CTNNA1 Phosphorylation S641 -0.056 0.089 _TPEELDDS(ph)DFETEDFDVR_
CTNNA1 Phosphorylation T654 0.808 0.392 _SRT(ph)SVQTEDDQLIAGQSAR_
CTNNA1 Phosphorylation S655 1.043 0.882 _SRTS(ph)VQTEDDQLIAGQSAR_
CTNNA1 Ubiquitylation K683 3.760 -0.837 _AIMAQLPQEQKAK(gl)_
CTNNA1 Ubiquitylation K747 -0.384 _NTSDVISAAK(gl)K_
CTNNA1 Ubiquitylation K748 -0.083 -0.384 _NTSDVISAAKK(gl)_
CTNNB1 Ubiquitylation K158 -1.265 _AIPELTK(gl)LLNDEDQVVVNK_
CTNNB1 Ubiquitylation K180 -0.546 -0.636 _AAVM(ox)VHQLSK(gl)K_
CTNNB1 Ubiquitylation K181 -0.717 -0.729 _AAVMVHQLSKK(gl)_
CTNNB1 Phosphorylation S191 -0.024 0.129 _S(ph)PQMVSAIVR_
CTNNB1 Ubiquitylation K435 -0.350 _NK(gl)MM(ox)VCQVGGIEALVR_
CTNNB1 Ubiquitylation K496 -1.262 _LHYGLPVVVK(gl)_
CTNNB1 Phosphorylation S552 1.233 1.224 _RTS(ph)MGGTQQQFVEGVR_
CTNNB1 Phosphorylation T556 1.275 0.995 _RTSM(ox)GGT(ph)QQQFVEGVR_
CTNNB1 Ubiquitylation K671 -0.941 -0.934 _MSEDKPQDYK(gl)K_
CTNND1 Ubiquitylation K25 0.530 0.979 _EQEAQFEK(gl)LTR_
CTNND1 Phosphorylation S252 -0.119 0.039 _APS(ph)RQDVYGPQPQVR_
CTNND1 Phosphorylation S268 -0.368 _VGGS(ph)SVDLHR_
CTNND1 Phosphorylation S288 1.010 0.270 _S(ph)M(ox)GYDDLDYGM(ox)M(ox)SDYGTAR_
CTNND1 Phosphorylation S349 1.049 0.905 _GSLAS(ph)LDSLRK_
CTNND1 Ubiquitylation K355 -1.397 -0.159 _K(gl)GGPPPPNWR_
CTNND1 Ubiquitylation K633 -1.794 _GK(gl)KPIEDPANDTVDFPKR_
CTNND1 Ubiquitylation K676 -0.804 _ESK(gl)TPAILEASAGAIQNLCAGR_
CTNND1 Phosphorylation S864 0.521 _SQSSHS(ph)YDDSTLPLIDR_
CTNND1 Phosphorylation Y865 0.634 0.963 _SQSSHSY(ph)DDSTLPLIDR_
CTNND1 Phosphorylation S899 0.562 _S(ph)GDLGDMEPLK_
CXADR Phosphorylation S332 -0.817 -0.804 _TPQS(ph)PTLPPAK_
DBN1 Ubiquitylation K71 0.340 _VMYGFCSVK(gl)DSQAALPK_
DBN1 Phosphorylation S142 0.400 0.388 _LSS(ph)PVLHR_
DBN1 Ubiquitylation K173 -0.431 0.569 _TDAAVEMK(gl)R_
DBN1 Phosphorylation T381 -1.321 _MAPTPIPT(ph)RSPSDSSTASTPVAEQIER_
DBN1 Phosphorylation S383 -0.385 0.782 _S(ph)PSDSSTASTPVAEQIER_
DBN1 Phosphorylation S385 0.730 0.642 _SPS(ph)DSSTASTPVAEQIER_
DBN1 Phosphorylation S391 1.790 _SPSDSSTAS(ph)TPVAEQIER_
DBN1 Phosphorylation T392 1.319 1.691 _SPSDSSTAST(ph)PVAEQIER_
DBN1 Phosphorylation T637 1.471 _EGT(ph)QASEGYFSQSQEEEFAQSEELCAK_
DBN1 Phosphorylation S640 0.320 0.823 _EGTQAS(ph)EGYFSQSQEEEFAQSEELCAK_
DBN1 Phosphorylation S645 1.551 _EGTQASEGYFS(ph)QSQEEEFAQSEELCAK_
DBN1 Phosphorylation S647 0.382 1.073 _EGTQASEGYFSQS(ph)QEEEFAQSEELCAK_
DLG1 Phosphorylation S102 -1.455 _SKPSEPIQPVNTWEISSLPSSTVTSETLPSSLS(ph)PSVEK_
DLG1 Phosphorylation T115 -0.707 -1.378 _YQDEDT(ph)PPQEHISPQITNEVIGPELVHVSEK_
DLG1 Phosphorylation S122 -1.073 _YQDEDTPPQEHIS(ph)PQITNEVIGPELVHVSEK_
DLG1 Phosphorylation S158 0.773 _NLSEIENVHGFVSHSHIS(ph)PIK_
DLG1 Ubiquitylation K321 1.264 1.435 _IMEIK(gl)LIK_
DLG1 Ubiquitylation K361 0.180 _IIEGGAAHK(gl)DGK_
DLG1 Ubiquitylation K452 -0.704 _YSPVSK(gl)AVLGDDEITREPR_
DLG1 Ubiquitylation K556 0.105 _FEAK(gl)IHDLR_
DLG1 Phosphorylation S573 0.697 _EQM(ox)M(ox)NSSISSGS(ph)GSLR_
DLG1 Phosphorylation S575 0.255 0.729 _EQMMNSSISSGSGS(ph)LR_
DLG1 Ubiquitylation K843 1.259 _SMENIMEMNK(gl)R_
DLG3 Phosphorylation S102 -1.455 _SKPSEPIQPVNTWEISSLPSSTVTSETLPSSLS(ph)PSVEK_
DLG3 Phosphorylation T115 -0.707 -1.378 _YQDEDT(ph)PPQEHISPQITNEVIGPELVHVSEK_
DLG3 Phosphorylation S122 -1.073 _YQDEDTPPQEHIS(ph)PQITNEVIGPELVHVSEK_
DLG3 Phosphorylation S158 0.773 _NLSEIENVHGFVSHSHIS(ph)PIK_
DLG3 Ubiquitylation K321 1.264 1.435 _IMEIK(gl)LIK_
DLG3 Ubiquitylation K361 0.180 _IIEGGAAHK(gl)DGK_
DLG3 Ubiquitylation K368 1.043 1.755 _IIEGGAAQK(gl)DGR_
DLG3 Ubiquitylation K452 -0.704 _YSPVSK(gl)AVLGDDEITREPR_
DLG3 Ubiquitylation K556 0.105 _FEAK(gl)IHDLR_
DLG3 Phosphorylation S573 0.697 _EQM(ox)M(ox)NSSISSGS(ph)GSLR_
DLG3 Phosphorylation S575 0.255 0.729 _EQMMNSSISSGSGS(ph)LR_
DLG3 Ubiquitylation K843 1.259 _SMENIMEMNK(gl)R_
DSG2 Phosphorylation S680 -0.220 -0.071 _VVPSFLPVDQGGS(ph)LVGR_
DSG2 Ubiquitylation K692 0.377 _NGVGGMAK(gl)EATMK_
DSG2 Ubiquitylation K697 0.688 0.914 _EATMK(gl)GSSSASIVK_
DSG2 Ubiquitylation K706 0.722 _GSSSASIVK(gl)GQHEMSEMDGR_
DSG2 Ubiquitylation K746 1.168 1.231 _ATQFTGATGAIM(ox)TTETTK(gl)TAR_
DSG2 Phosphorylation S782 0.571 _AAS(ph)YTEEDENHTAK_
DSP Phosphorylation S22 0.083 -0.070 _AES(ph)GPDLR_
DSP Ubiquitylation K94 0.120 _AELIVQPELK(gl)YGDGIQLTR_
DSP Ubiquitylation K140 0.440 0.037 _QMGQPCDAYQK(gl)R_
DSP Ubiquitylation K154 0.266 -0.098 _ALYK(gl)AISVPR_
DSP Phosphorylation S176 0.188 _GGGGYTCQS(ph)GSGWDEFTK_
DSP Ubiquitylation K239 -0.069 _WQLDKIK(gl)_
DSP Ubiquitylation K322 1.259 _MSQLEVK(gl)EK_
DSP Ubiquitylation K324 1.259 _MSQLEVK(gl)EK_
DSP Ubiquitylation K1028 1.475 _SLEDLK(gl)LK_
DSP Ubiquitylation K1802 0.287 1.314 _IQESK(gl)NQCTQVVQER_
DSP Phosphorylation S2209 0.704 1.055 _SMS(ph)FQGIR_
DSP Phosphorylation S2606 -0.052 -0.018 _S(ph)SSFSDTLEESSPIAAIFDTENLEK_
DSP Phosphorylation S2608 0.063 0.167 _SSS(ph)FSDTLEESSPIAAIFDTENLEK_
DSP Phosphorylation S2632 1.154 _SSSFSDTLEESS(ph)PIAAIFDTENLEKIS(ph)ITEGIERGIVDSITGQR_
DSP Ubiquitylation K2811 -0.793 _LLEAASVSSK(gl)GLPSPYNMSSAPGSR_
DSP Phosphorylation S2815 -1.038 -0.597 _GLPS(ph)PYNMSSAPGSR_
DSP Phosphorylation S2820 -0.905 -0.967 _GLPSPYNMS(ph)SAPGSR_
DSP Phosphorylation S2821 -0.690 -0.873 _GLPSPYNMSS(ph)APGSR_
DSP Phosphorylation S2825 -1.381 -0.714 _GLPSPYNM(ox)SSAPGS(ph)R_
EPB41L3 Phosphorylation T2 -0.189 _(ac)M(ox)T(ph)TESGSDSESKPDQEAEPQEAAGAQGR_
EPB41L3 Phosphorylation S5 -0.015 _(ac)TTES(ph)GSDSESKPDQEAEPQEAAGAQGR_
EPB41L3 Phosphorylation S7 0.398 _TTESGS(ph)DSESKPDQEAEPQEAAGAQGR_
EPB41L3 Phosphorylation S55 -1.826 _AGAPVPEPPKEEQQQALEQFAAAAAHS(ph)TPVRR_
EPB41L3 Phosphorylation T56 -1.710 _AGAPVPEPPKEEQQQALEQFAAAAAHS(ph)TPVRR_
EPB41L3 Ubiquitylation K65 1.020 1.593 _EVTDK(gl)EQEFAAR_
EPB41L3 Ubiquitylation K75 1.272 _AAK(gl)QLEYQQLEDDKLSQK_
EPB41L3 Phosphorylation S88 0.840 1.043 _QLEYQQLEDDKLS(ph)QK_
EPB41L3 Ubiquitylation K128 0.319 _VILLDGSEYTCDVEK(gl)R_
EPB41L3 Ubiquitylation K162 -0.060 _DAENQK(gl)NWLDPAK_
EPB41L3 Ubiquitylation K266 -0.008 _ELEDK(gl)VIELHK_
EPB41L3 Phosphorylation S420 -0.386 0.049 _RAS(ph)ALIDRPAPYFER_
EPB41L3 Phosphorylation S443 0.847 0.830 _S(ph)LDGASVNENHEIYMK_
EPB41L3 Phosphorylation S448 0.617 0.533 _SLDGAS(ph)VNENHEIYMK_
EPB41L3 Phosphorylation S460 0.909 0.003 _DS(ph)MSAAEVGTGQYATTK_
EPB41L3 Phosphorylation S462 1.413 0.882 _DSM(ox)S(ph)AAEVGTGQYATTK_
EPB41L3 Ubiquitylation K472 0.411 _GISQTNLITTVTPEK(gl)K_
EPB41L3 Ubiquitylation K473 0.411 _GISQTNLITTVTPEK(gl)K_
EPB41L3 Ubiquitylation K475 -0.076 _DSMSAAEVGTGQYATTK(gl)GISQTNLITTVTPEKK_
EPB41L3 Phosphorylation S478 0.929 0.825 _GIS(ph)QTNLITTVT(ph)PEKK_
EPB41L3 Phosphorylation T485 0.378 1.025 _GISQTNLITT(ph)VTPEKK_
EPB41L3 Phosphorylation T487 0.317 0.583 _GIS(ph)QTNLITTVT(ph)PEK_
EPB41L3 Ubiquitylation K490 0.411 _GISQTNLITTVTPEK(gl)K_
EPB41L3 Ubiquitylation K491 0.411 _GISQTNLITTVTPEK(gl)K_
EPB41L3 Ubiquitylation K505 -0.213 _K(gl)GEEVTPISAIR_
EPB41L3 Phosphorylation T510 -0.011 0.051 _KGEEVT(ph)PISAIR_
EPB41L3 Ubiquitylation K570 1.272 0.676 _HQTNISELK(gl)R_
EPB41L3 Ubiquitylation K588 0.598 _TFLETSTDTAVTNEWEK(gl)R_
EPB41L3 Phosphorylation T592 1.233 _RLS(ph)T(ph)SPVR_
EPB41L3 Phosphorylation S593 0.571 0.742 _LSTS(ph)PVR_
EPB41L3 Phosphorylation S791 0.502 1.134 _TETISFGS(ph)VSPGGVK_
EPB41L3 Phosphorylation S793 0.573 1.236 _TETISFGSVS(ph)PGGVK_
EPB41L3 Ubiquitylation K1061 0.496 _EAK(gl)EQHPDMSVTK_
F11R Phosphorylation S288 0.335 0.373 _VIYSQPS(ph)AR_
F11R Ubiquitylation K296 0.445 0.876 _SEGEFK(gl)QTSSFLV_
FAT1 Ubiquitylation K313 -0.225 _SFPGSK(gl)EYK_
FAT1 Ubiquitylation K1542 -1.093 _DQDVPVK(gl)R_
FAT1 Ubiquitylation K4351 -1.682 -1.804 _KPLEEK(gl)PSQPYSAR_
ILK Ubiquitylation K85 -0.777 _DIVQK(gl)LLQYK_
ILK Ubiquitylation K426 -0.300 _LMK(gl)ICMNEDPAK_
ILK Ubiquitylation K435 -2.732 _ICMNEDPAK(gl)RPK_
IQGAP1 Ubiquitylation K953 0.650 _NKEQLSDMMMINK(gl)QK_
IQGAP1 Ubiquitylation K959 0.713 0.074 _GGLK(gl)ALSK_
IQGAP1 Ubiquitylation K1389 0.638 1.119 _TILLNTK(gl)R_
IQGAP1 Ubiquitylation K1442 0.488 _SK(gl)SVKEDSNLTLQEK_
IQGAP1 Phosphorylation S1443 0.392 0.273 _SKS(ph)VKEDSNLTLQEK_
IQGAP1 Ubiquitylation K1445 0.863 _SVK(gl)EDSNLTLQEK_
IQGAP3 Ubiquitylation K661 0.344 _ALESAMAKK(gl)_
IQGAP3 Phosphorylation T1426 -0.517 _SLT(ph)AHSLLPLAEK_
ITGA5 Phosphorylation S127 0.200 0.067 _LLESSLSS(ph)SEGEEPVEYK_
ITGA5 Phosphorylation S128 -0.087 _LLESSLSSS(ph)EGEEPVEYK_
ITGB1 Ubiquitylation K774 0.402 _MNAK(gl)WDTGENPIYK_
ITGB1 Ubiquitylation K784 -0.172 0.350 _WDTGENPIYK(gl)SAVTTVVNPK_
ITGB1 Ubiquitylation K794 0.755 0.604 _SAVTTVVNPK(gl)YEGK_
KIAA1462 Phosphorylation S185 0.293 _WQNVS(ph)LESWNQPR_
KIAA1462 Phosphorylation S237 0.181 0.185 _VLS(ph)PESLSCTEIPIPLNER_
KIAA1462 Phosphorylation T691 -0.234 _DQQT(ph)QTSFSEEPQSSQLLPGAK_
KIAA1462 Phosphorylation S694 -0.262 -0.384 _DQQTQTS(ph)FSEEPQSSQLLPGAK_
KIAA1462 Phosphorylation S757 0.371 0.581 _SLS(ph)PSSNSAFSR_
KIAA1462 Phosphorylation S770 0.036 -0.074 _TSLS(ph)VDQAPTPK_
KIAA1462 Phosphorylation S1044 0.211 0.286 _GLS(ph)APDLR_
KIAA1462 Phosphorylation S1123 -1.182 _AGQNQPAEPDASACTPES(ph)PQEELLSRPAPADVPR_
KIAA1462 Phosphorylation S1281 0.527 0.939 _NADS(ph)QEDAEELK_
KIAA1462 Phosphorylation S1304 1.283 0.953 _GQAGLPGGLVS(ph)PGSGDR_
KIAA1462 Phosphorylation S1317 1.066 _LGHS(ph)LSVSK_
KIAA1462 Phosphorylation S1319 1.434 0.889 _LGHSLS(ph)VSK_
KIRREL Ubiquitylation K582 0.846 _AIYSSFKDDVDLK(gl)QDLR_
KIRREL Ubiquitylation K729 0.190 0.056 _TPYEAYDPIGK(gl)YATATR_
LDB1 Ubiquitylation K76 -0.052 _IFELNK(gl)R_
LDB1 Ubiquitylation K271 -0.154 _DCLK(gl)TCLFQK_
LDB1 Ubiquitylation K277 -1.611 -0.630 _TCLFQK(gl)WQR_
LDB1 Phosphorylation S323 -0.402 -0.031 _KS(ph)PASTFALSSQVPDVMVVGEPTLMGGEFGDEDER_
LIN7C Ubiquitylation K76 0.092 _ANATAK(gl)ATVAAFAASEGHSHPR_
LIN7C Ubiquitylation K161 0.279 0.161 _AVELLK(gl)AAQGK_
LIN7C Ubiquitylation K176 -0.064 0.362 _YTPK(gl)VLEEMESR_
MAGI3 Phosphorylation S722 -0.403 _S(ph)GSPKLDPSEVYLK_
MAGI3 Phosphorylation S724 -0.403 _SGS(ph)PKLDPSEVYLK_
MAP2K2 Phosphorylation S23 0.873 0.258 _RKPVLPALTINPTIAEGPS(ph)PTSEGASEANLVDLQK_
MAP2K2 Phosphorylation T25 0.439 _RKPVLPALTINPTIAEGPSPT(ph)SEGASEANLVDLQK_
MAP2K2 Ubiquitylation K192 -0.205 -0.241 _DVK(gl)PSNILVNSR_
MAP2K2 Phosphorylation S293 -0.361 _ELEAIFGRPVVDGEEGEPHS(ph)ISPR_
MAP2K2 Phosphorylation S295 -0.234 0.026 _ELEAIFGRPVVDGEEGEPHSIS(ph)PR_
MAP2K2 Phosphorylation T394 0.570 0.158 _LNQPGT(ph)PTR_
MLLT4 Phosphorylation S216 0.045 0.221 _TIS(ph)NPEVVMK_
MLLT4 Ubiquitylation K1042 -0.441 _SVVK(gl)GGAADVDGR_
MLLT4 Phosphorylation S1083 -1.359 _TSS(ph)VVTLEVAK_
MLLT4 Phosphorylation S1107 0.858 0.054 _QGAIYHGLATLLNQPS(ph)PMMQR_
MLLT4 Phosphorylation S1172 -0.906 -1.359 _S(ph)SPNVANQPPS(ph)PGGK_
MLLT4 Phosphorylation S1173 -0.957 -1.174 _SS(ph)PNVANQPPS(ph)PGGK_
MLLT4 Phosphorylation S1182 -0.606 -0.764 _SSPNVANQPPS(ph)PGGK_
MLLT4 Phosphorylation T1211 -0.552 _ITSVSTGNLCTEEQT(ph)PPPRPEAYPIPTQTYTR_
MLLT4 Phosphorylation S1275 0.682 1.367 _S(ph)QEELREDK_
MLLT4 Phosphorylation S1696 -2.036 -1.851 _DYEPPS(ph)PSPAPGAPPPPPQR_
MLLT4 Phosphorylation S1698 -3.791 _DYEPPSPS(ph)PAPGAPPPPPQR_
MLLT4 Phosphorylation S1721 0.872 0.984 _TQVLS(ph)PDSLFTAK_
MLLT4 Phosphorylation S1779 0.084 0.426 _SQDADS(ph)PGSSGAPENLTFK_
MLLT4 Phosphorylation S1799 0.590 0.104 _LFS(ph)QGQDVSNK_
OCLN Ubiquitylation K330 -0.208 -0.513 _VDSPMAYSSNGK(gl)VNDKR_
OCLN Phosphorylation S341 -0.395 -0.095 _RFYPESS(ph)YK_
OCLN Phosphorylation T357 0.065 0.472 _STPVPEVVQELPLT(ph)SPVDDFR_
OCLN Phosphorylation S358 0.095 0.535 _STPVPEVVQELPLTS(ph)PVDDFR_
OCLN Phosphorylation S370 0.069 0.114 _YSS(ph)GGNFETPSK_
OCLN Phosphorylation T376 -1.372 -1.062 _YSSGGNFET(ph)PSK_
OCLN Ubiquitylation K379 -0.036 0.238 _YSSGGNFETPSK(gl)R_
OCLN Phosphorylation S408 1.405 _RTEQDHYETDYTTGGES(ph)CDELEEDWIR_
OCLN Ubiquitylation K488 0.113 _LKQVK(gl)GSADYK_
PAK1 Phosphorylation S174 -1.439 -0.597 _AVSETPAVPPVS(ph)EDEDDDDDDATPPPVIAPRPEHTK_
PAK1 Phosphorylation T212 0.312 _SVIEPLPVT(ph)PTR_
PAK1 Phosphorylation T219 -0.560 -0.962 _DVAT(ph)SPISPTENNTT(ph)PPDALTR_
PAK1 Phosphorylation S220 -0.916 -0.774 _DVATS(ph)PISPTENNTTPPDALTR_
PAK1 Phosphorylation S223 1.033 0.153 _DVATSPIS(ph)PTENNTTPPDALTR_
PAK1 Phosphorylation T225 -1.278 _DVATSPISPT(ph)ENNTTPPDALTR_
PAK1 Phosphorylation T230 -1.418 -1.502 _DVATSPISPTENNTT(ph)PPDALTR_
PARD3 Phosphorylation S143 -0.152 0.186 _RS(ph)SDPALIGLSTSVSDSNFSSEEPSR_
PARD3 Phosphorylation S144 0.099 -0.057 _RS(ph)SDPALIGLSTSVSDSNFSSEEPSR_
PARD3 Phosphorylation S383 0.377 0.343 _FS(ph)PDSQYIDNR_
PARD3 Phosphorylation T579 2.050 2.128 _AEDEDIVLT(ph)PDGTR_
PARD3 Phosphorylation S692 -0.647 -0.931 _S(ph)PGSPPGPELPIETALDDRER_
PARD3 Phosphorylation S695 -0.895 -1.092 _SPGS(ph)PPGPELPIETALDDRER_
PARD3 Phosphorylation S715 1.428 -0.219 _RIS(ph)HSLYSGIEGLDESPSR_
PARD3 Phosphorylation S728 -0.196 0.339 _ISHSLYSGIEGLDES(ph)PSR_
PARD3 Phosphorylation S795 0.353 -0.344 _S(ph)M(ox)DLVADETK_
PARD3 Phosphorylation S809 2.141 1.530 _AAISDSADCSLS(ph)PDVDPVLAFQR_
PARD3 Phosphorylation S850 1.009 1.041 _S(ph)KSMDLGIADETK_
PARD3 Phosphorylation S852 0.640 0.638 _S(ph)MDLGIADETK_
PARD3 Ubiquitylation K886 -0.879 _DVGPSLGLKK(gl)_
PARD3 Phosphorylation S973 -0.243 -0.400 _ESVSTASDQPSHS(ph)LER_
PARD3 Phosphorylation S1178 -0.282 -0.511 _TYS(ph)FEQPWPNAR_
PCDH1 Phosphorylation S984 -1.316 _SNS(ph)PLPSIQLQPQS(ph)PSASK_
PCDH1 Phosphorylation S995 -1.121 _SNS(ph)PLPSIQLQPQS(ph)PSASK_
PKP2 Phosphorylation S82 0.172 0.473 _TSS(ph)VPEYVYNLHLVENDFVGGR_
PKP2 Ubiquitylation K134 0.755 -0.110 _GTAQYSSQK(gl)SVEER_
PKP2 Phosphorylation S135 0.873 0.521 _GTAQYSSQKS(ph)VEER_
PKP2 Phosphorylation S151 0.440 0.323 _RLEIS(ph)PDSSPER_
PKP2 Phosphorylation S154 0.267 0.205 _LEISPDS(ph)SPER_
PKP2 Phosphorylation S155 -0.249 0.172 _RLEISPDSS(ph)PER_
PKP2 Phosphorylation S329 0.351 0.264 _AHLTVGQAAAGGS(ph)GNLLTER_
PKP2 Ubiquitylation K643 1.209 0.678 _NIQTDNNK(gl)SIGCFGSR_
PKP4 Phosphorylation S75 0.390 -0.006 _LGAES(ph)PSIASTSSTEK_
PKP4 Phosphorylation S221 -0.272 -0.602 _AQS(ph)PSYVISTGVS(ph)PSR_
PKP4 Phosphorylation S231 -0.562 -0.103 _AQS(ph)PSYVISTGVS(ph)PSR_
PKP4 Phosphorylation S273 -0.230 -0.252 _AAS(ph)PYSQRPAS(ph)PTAIR_
PKP4 Phosphorylation S276 -0.230 0.429 _AAS(ph)PYS(ph)QRPASPTAIR_
PKP4 Phosphorylation S281 0.155 0.243 _AAS(ph)PYSQRPAS(ph)PTAIR_
PKP4 Phosphorylation S314 0.714 0.627 _VGS(ph)PLTLTDAQTR_
PKP4 Phosphorylation S327 0.346 0.137 _VAS(ph)PSQGQVGS(ph)SSPK_
PKP4 Phosphorylation S336 0.308 0.260 _VASPSQGQVGSS(ph)SPKR_
PKP4 Phosphorylation S337 0.059 -0.044 _VAS(ph)PSQGQVGSSS(ph)PK_
PKP4 Phosphorylation S406 0.873 0.653 _SAVS(ph)PDLHITPIYEGR_
PKP4 Phosphorylation S447 0.245 0.506 _TGS(ph)VGIGNLQR_
PKP4 Ubiquitylation K518 -1.745 -1.024 _SPSIDSIQK(gl)DPR_
PKP4 Phosphorylation S776 1.519 _LLGLNELDDLLGKES(ph)PSKDSEPSCWGK_
PNN Phosphorylation S66 1.278 0.098 _GFS(ph)DSGGGPPAK_
PNN Phosphorylation S100 -0.228 0.216 _QES(ph)DPEDDDVKKPALQSSVVATSK_
PNN Ubiquitylation K137 -0.413 _DLIQDQNMDEK(gl)GK_
PNN Ubiquitylation K139 -0.190 _DLIQDQNMDEKGK(gl)_
PNN Phosphorylation S347 0.676 0.756 _EIAIVHS(ph)DAEKEQEEEEQKQEM(ox)EVK_
PNN Phosphorylation S375 1.918 1.229 _ES(ph)EKQQDSQPEEVMDVLEM(ox)VENVK_
PNN Phosphorylation S381 1.691 1.654 _QQDS(ph)QPEEVM(ox)DVLEM(ox)VENVK_
PNN Phosphorylation S441 0.535 0.333 _S(ph)LSPGKENVSALDMEK_
PNN Phosphorylation S443 0.564 0.502 _SLS(ph)PGKENVSALDMEK_
PRKCD Ubiquitylation K138 -0.141 _SEDEAK(gl)FPTMNR_
PRKCD Ubiquitylation K222 0.185 0.658 _DTIFQK(gl)ER_
PRKCD Phosphorylation S302 -0.240 -0.222 _S(ph)DSASSEPVGIYQGFEK_
PRKCD Phosphorylation S304 0.378 0.289 _RSDS(ph)ASSEPVGIYQGFEK_
PRKCD Phosphorylation S506 -0.213 0.200 _AS(ph)TFCGTPDYIAPEILQGLK_
PRKCD Phosphorylation T507 -0.149 0.240 _AS(ph)TFCGTPDYIAPEILQGLK_
PRKCD Ubiquitylation K641 -2.000 _DYSNFDQEFLNEK(gl)AR_
PRKCD Phosphorylation S645 0.577 0.832 _ARLS(ph)YSDK_
PRKCD Phosphorylation S647 0.886 0.853 _ARLSYS(ph)DK_
PRKCZ Phosphorylation T560 -0.884 -1.578 _KQALPPFQPQITDDYGLDNFDTQFTSEPVQLT(ph)PDDEDAIKR_
PRKD1 Phosphorylation S207 0.941 1.048 _RLS(ph)NVSLTGVSTIR_
PRKD1 Phosphorylation T219 -0.068 -0.162 _T(ph)SSAELSTSAPDEPLLQK_
PRKD1 Phosphorylation S221 -0.662 -0.500 _TSS(ph)AELSTSAPDEPLLQK_
PRKD1 Phosphorylation S225 -0.970 -0.919 _TSSAELSTS(ph)APDEPLLSPVSPGFEQK_
PRKD1 Phosphorylation S236 -0.132 _TSSAELSTSAPDEPLLSPVS(ph)PGFEQK_
PRKD1 Phosphorylation S251 0.474 0.751 _SNS(ph)QSYIGRPIHLDK_
PRKD1 Phosphorylation S399 0.023 0.162 _TIS(ph)PSTSNNIPLMR_
PRKD1 Ubiquitylation K730 1.177 _IIGEK(gl)SFR_
PRKD1 Phosphorylation S744 -0.226 -0.287 _S(ph)VVGTPAYLAPEVLR_
PTK7 Ubiquitylation K843 0.757 0.315 _SLQSK(gl)DEQQQLDFRR_
PTK7 Ubiquitylation K906 0.519 -0.411 _LK(gl)SQPLSTK_
PTPRU Phosphorylation S853 -0.196 -0.039 _SGGVTEASSLLGGS(ph)PR_
PVRL2 Phosphorylation T410 -1.005 _EQTLQGAEEDEDLEGPPSYKPPT(ph)PK_
PVRL2 Phosphorylation S430 0.026 _LEAQEMPSQLFTLGAS(ph)EHSPLK_
PVRL2 Phosphorylation S433 -0.325 _LEAQEMPSQLFTLGASEHS(ph)PLK_
RAB10 Ubiquitylation K163 0.199 _LLLGNK(gl)CDMEAK_
RAB10 Ubiquitylation K174 -0.188 _VQK(gl)EQADKLAR_
RAB10 Ubiquitylation K213 -0.059 0.420 _DILLK(gl)SGGR_
RAP1B Ubiquitylation K174 0.197 _KTPVPGK(gl)AR_
RAPGEF2 Phosphorylation S1022 0.043 -0.570 _SETS(ph)PVAPR_
RAPGEF2 Phosphorylation S1080 -0.612 _DLPPFGINS(ph)PQALK_
SDCCAG8 Phosphorylation S4 1.097 1.380 _(ac)AKS(ph)PENSTLEEILGQYQR_
SHROOM2 Phosphorylation S1337 -0.977 -0.027 _SLADILDPS(ph)VKIK_
SLC2A1 Ubiquitylation K270 -1.109 0.356 _GTADVTHDLQEM(ox)K(gl)EESR_
SLC2A1 Ubiquitylation K502 -1.643 _QGGASQSDK(gl)TPEELFHPLGADSQV_
TIAM1 Phosphorylation S231 0.453 0.331 _ANS(ph)LGDLYAQK_
TIAM1 Phosphorylation T1405 0.267 _T(ph)ESLPSSQQYVPFGGK_
TIAM1 Phosphorylation S1407 -0.862 -0.252 _TES(ph)LPSSQQYVPFGGK_
TJP1 Ubiquitylation K54 0.081 -0.398 _GSLLPLK(gl)R_
TJP1 Ubiquitylation K157 0.023 -0.755 _SEK(gl)IWPR_
TJP1 Phosphorylation S175 0.113 -0.041 _S(ph)VASSQPAKPTK_
TJP1 Ubiquitylation K187 -0.394 _SVASSQPAK(gl)PTK_
TJP1 Ubiquitylation K198 0.760 0.143 _SRK(gl)NEEYGLR_
TJP1 Phosphorylation S329 -0.569 -0.354 _HS(ph)PQQPSNGSLR_
TJP1 Phosphorylation S353 -0.522 -0.375 _ISKPGAVS(ph)TPVK_
TJP1 Phosphorylation S617 0.438 0.543 _S(ph)REDLSAQPVQTK_
TJP1 Ubiquitylation K677 -0.484 _EEPDIYQIAK(gl)SEPR_
TJP1 Phosphorylation S912 -0.113 _IDS(ph)PGFKPASQQK_
TJP1 Phosphorylation S916 -0.049 0.102 _IDS(ph)PGFKPASQQVYR_
TJP1 Ubiquitylation K920 7.379 6.153 _IDSPGFK(gl)PASQQVYR_
TJP1 Phosphorylation S968 -0.778 _LEEPTPAPSTSYS(ph)PQADSLR_
TJP1 Phosphorylation S1579 0.045 -0.197 _SHS(ph)LAQPPEFDSGVETFSIHAEKPK_
TJP1 Phosphorylation S1617 0.665 _AIPVS(ph)PSAVEEDEDEDGHTVVATAR_
TLN1 Ubiquitylation K334 -0.489 0.561 _LLGITK(gl)ECVM(ox)R_
TLN1 Phosphorylation S423 0.105 _DHFGLEGDEESTMLEDS(ph)VSPKK_
TLN1 Phosphorylation S425 -0.366 -0.322 _DHFGLEGDEESTMLEDSVS(ph)PKK_
TLN1 Ubiquitylation K869 -0.260 _ILADATAK(gl)MVEAAK_
TLN1 Ubiquitylation K1541 0.365 2.311 _EVANSTANLVK(gl)TIK_
TLN1 Ubiquitylation K2021 0.309 0.479 _EGILK(gl)TAK_
TLN2 Phosphorylation T1843 -0.647 _LDEGT(ph)PPEPK_
TWF1 Phosphorylation S143 1.600 0.975 _YLLSQSS(ph)PAPLTAAEEELR_
VANGL2 Ubiquitylation K379 0.582 _LQEEEQK(gl)NPR_
VCL Ubiquitylation K219 -0.376 0.161 _NSK(gl)NQGIEEALK_
VCL Ubiquitylation K228 0.195 _NQGIEEALK(gl)NR_
VCL Phosphorylation S288 0.364 _DPS(ph)ASPGDAGEQAIR_
VCL Phosphorylation S290 -0.415 _DPSAS(ph)PGDAGEQAIR_
VCL Ubiquitylation K476 0.572 0.356 _QVATALQNLQTK(gl)TNR_
VCL Ubiquitylation K639 0.665 0.718 _AANFENHSGK(gl)LGATAEK_
VCL Ubiquitylation K666 0.502 _STVEGIQASVK(gl)TAR_
VCL Ubiquitylation K768 0.256 _ILLVAK(gl)R_
VCL Ubiquitylation K784 -0.707 _EAVK(gl)AASDELSK_
VCL Ubiquitylation K792 -0.889 -1.201 _AASDELSK(gl)TISPMVMDAK_
VCL Ubiquitylation K815 -0.780 _AVAGNISDPGLQK(gl)SFLDSGYR_
VCL Ubiquitylation K1020 0.159 0.667 _ALIQCAK(gl)DIAK_
VCL Ubiquitylation K1070 0.504 0.692 _ILSTVK(gl)ATMLGR_


.

© Copyright Svejstrup Laboratory 2015