bioLOGIC Data » bioLOGIC CategoryView » bioLOGIC VennView » Experimental Details »
bioLOGIC Category

Results for the Category
Prot_kinase_dom
(IPR000719)

RNAi screen result RNAPII IP (MG132) CSB IP CSB IP (MG132) Chrom. Chrom. (MG132) Ubi /Phospo Ubi /Phospho (MG132)
W

Protein Results:

Results for post-translational modifications (below)
Gene name MGoogle Score RNAi high RNAi low RNAPII-IP (MG132) CSB-IP CSB-IP (MG132) Chrom. Chrom. (MG132)
SCYL3 3 2.480 -1.250
MARK2 2 0.390 -0.570 -0.342 -0.924
GSK3B 2 1.020 -0.870 -1.128 1.091
MYO3A 2 -1.560 3.110
SRPK1 2 -2.020 3.440
SRPK1 2 -2.020 3.440 -0.227 0.204
SRPK1 2 -2.020 3.440 1.541 -0.249 -0.327
GSK3A 2 -1.420 1.510 -1.128 1.091
GSK3A 2 -1.420 1.510
MAPK14 2 -0.160 -0.350
AKT3 2 0.580 -0.030 -0.194
AKT3 2 0.580 -0.030
EPHA7 2 2.050 -0.990 0.221
EPHA7 2 2.050 -0.990
CDK9 2 -1.000 1.130 2.047 1.362 1.840 1.146 0.280
CAMK2G 2 -2.070 4.160
CAMK2G 2 -2.070 4.160
CAMK2G 2 -2.070 4.160 -0.654 0.073
CAMK2G 2 -2.070 4.160 0.559 1.698
CHEK1 2 -1.170 1.560
CHEK1 2 -1.170 1.560
TNIK 2 -2.250 5.030 0.038 0.092 0.062
TNIK 2 -2.250 5.030 -0.852 -0.525
PLK1 2 3.098 -0.387 0.212 -1.949 -0.610
INSR 2 -0.850 0.830 1.143 0.785
CHEK2 2 0.530 0.100
FYN 1 1.080 -1.100
FYN 1 1.080 -1.100
MAP4K5 1 -0.392
MAPK9 1 0.110 -0.490
CAMK2B 1 1.200 -0.790
CAMK2B 1 1.200 -0.790 -0.654 0.073
CAMK2B 1 1.200 -0.790 -0.619 0.544 0.125
CAMK2B 1 1.200 -0.790 0.559 1.698
WNK1 1 -2.390 5.600 0.546 0.639
WNK1 1 -0.180 0.010 0.546 0.639
MAPK6 1 2.490 -0.970 -3.989
MAPK6 1 2.490 -0.970 0.892
CSNK2A2 1 -2.450 5.260 1.102 -0.224 1.364 -0.368 -0.150
MARK3 1 -0.380 -0.380
MARK3 1 -0.380 -0.380 -1.027 -0.513
SRPK3 1 -0.520 0.710 1.541 -0.249 -0.327
CDK16 1 -1.400 2.950
CDK16 1 -1.400 2.950
CDK16 1 -1.400 2.950 -0.510 0.013
RIPK2 1 -1.740 3.580
CSNK1A1 1 0.080 -0.140 2.048 -0.562 0.195 -0.389 0.187
CIT 1 -1.740 3.570 -1.113 0.349
RAF1 1 2.020 -1.230
RNASEL 1 -0.830 1.400 1.079 -0.385 0.549 0.456
NEK1 1 -1.440 3.230
BMP2K 1 2.210 -0.920 0.289 -0.421
IGF1R 1 -0.490 0.750 1.476 0.714
FIP1L1 1 -1.930 3.940 0.293 -0.487 0.231 -0.419 0.354
CASK 1 2.050 -1.110
CASK 1 2.050 -1.110 -0.162 -0.217 -0.918 0.048 0.372
TTN 1 2.130 -1.190 0.133 0.277 0.244 0.213
BUB1B 1 -1.750 3.130
TAOK1 1 -2.360 4.940 1.169
STK17A 1 -2.380 4.520
ILK 1 -1.560 3.680 -0.463 -0.527
WEE1 1 -1.790 2.530 0.694
MAP2K1 1 -1.590 2.780
CSNK1G1 1 -1.760 3.030 -0.583 0.273
OXSR1 1 1.270 -0.800 -2.421 0.540 0.889
PEAK1 1 -0.110 0.550
CLK2 1 2.010 -1.310 0.077 0.840
RPS6KA3 1 -1.550 2.890
CSNK1A1L 1 1.800 -1.110 2.048 -0.562 0.195 -0.389 0.187
PIK3R4 1 1.400 -0.950 1.537 -1.555 0.077
RPS6KL1 1 -0.180 0.110
LYN 1 -1.790 3.770
LYN 1 -1.790 3.770
CAMKK1 0 0.380 0.000
MARK4 0 0.660 -0.680
CDK11A 0 -0.340 0.640 0.520 0.139 1.329 0.365 0.320
CDK11A 0 0.040 -0.200 0.520 0.139 1.329 0.365 0.320
CLK1 0 -0.740 1.390 0.612 0.032
PRKCH 0 1.450 -1.320
VRK2 0 0.750 -0.170 -0.922
MAP2K3 0 0.780 -0.600
FLT4 0 0.940 -0.560
TRIO 0 -0.690 0.810 0.256 0.123
EIF2AK2 0 -1.060 1.180 -0.657 -0.502 0.213 -0.027
CDK14 0 -0.020 0.360 -0.510 0.013
CDK17 0 1.060 -0.600
CDK17 0 1.060 -0.600 -0.510 0.013
WNK2 0 -0.660 0.130 0.546 0.639
WNK3 0 -0.110 -0.490 0.546 0.639
HIPK2 0 -0.990 0.680
PKN2 0 0.530 -0.200 -0.561 -0.138 0.314
MYLK 0 -0.520 0.000 0.754
MAP2K4 0 -0.300 0.320
SLK 0 0.530 -0.730 0.497
PRKCQ 0 0.410 0.020
CDK13 0 -0.100 0.210 -0.507 -0.248
PRKCZ 0 -0.290 0.310
ROCK1 0 -1.420 2.380 -0.112 -0.732
FGFR3 0 -1.120 1.390
MAST4 0 0.540 -0.340
MAST4 0 0.720 -0.340
MAPK1 0 -0.500 0.330 0.892
MAPK3 0 0.892
MAPK4 0 0.892
CAMK2A 0 -0.430 0.130 -0.654 0.073
CAMK2A 0 -0.430 0.130 -0.619 0.544 0.125
MAP4K4 0 -0.500 0.030 0.038 0.092 0.062
MAP4K4 0 -0.500 0.030
PRKACA 0 0.380 -0.680 -1.005 -0.697 0.234 0.487
RPS6KA6 0 -1.250 1.770
STK10 0 -1.430 2.450
MAP2K7 0 0.180 -0.660 -2.110
FGFR1 0 0.210 0.150
ARAF 0 0.550 -0.670
ARAF 0 0.550 -0.670
EPHA6 0 -1.140 1.990 0.221
EPHA6 0 -0.490 0.330 0.221
STK17B 0 0.770 -0.450
MAP3K4 0 0.000 0.450
MAST2 0 -0.170 0.680
EIF2AK1 0 0.570 -0.840
AURKA 0 -0.450 -0.060 -2.905 -1.603
MAPKAPK5 0 1.100 -0.730
TYRO3 0 0.220 -0.340
MAP3K1 0 0.750 -1.270
ABL1 0 0.670 -0.070
CDC7 0 -0.450 -0.150 -0.803
MAST3 0 -0.520 0.530
CDKL1 0 -0.310 -0.290
VRK1 0 -0.320 0.590 1.054 -0.770 0.352 0.310
STK4 0 0.260 -0.240
STK4 0 0.260 -0.240
STK4 0 0.260 -0.240 -0.235 -0.851
PTK6 0 -0.300 0.700 0.520 0.139 1.329 0.365 0.320
CSNK2A1 0 0.050 -0.020 0.030 -0.550 1.362 0.022 -0.045
STK24 0 0.490 -0.300 -0.371 0.364
STK24 0 0.490 -0.300 -0.052
STK24 0 0.490 -0.300
FLT1 0 -1.240 1.900
MAPK3 0
CSK 0 1.200 -0.960 -1.211
CSK 0 1.200 -0.960
IKBKB 0 0.400 0.610
STK3 0 -0.570 0.720
STK3 0 -0.570 0.720 -0.235 -0.851
DMPK 0 -0.990 1.550 0.369 0.295
VRK3 0 -0.220 1.020
VRK3 0 -0.220 1.020 0.343 1.144
AURKC 0 0.270 -0.250 -2.905 -1.603
DYRK1B 0 0.340 -0.930
AKT2 0 -1.420 2.210 -0.194
PRKD2 0 0.050 0.170 0.914
PRKD2 0 0.050 0.170
CDK6 0 -0.190 0.160
CDK6 0 -0.190 0.160 -0.510 0.013
MET 0 -0.010 -0.330
TGFBR1 0 -0.260 0.020
BMPR1A 0 0.020 -0.130
RPS6KB1 0 0.850 -0.600
MAP2K6 0 1.270 -0.780
CAMKK2 0 1.040 -0.430
CAMKK2 0 1.040 -0.430
STK38 0 -0.700 0.020 -0.949 -1.108 -0.051
PTK7 0 -0.240 0.340 -0.232 0.174
PRPF4B 0 -0.470 -0.010
PRPF4B 0 -0.470 -0.010 0.994 0.726 0.488 0.136 0.264
TTK 0 1.100 -0.950 -1.137 -0.932
CLK4 0 -1.070 0.840 0.612 0.032
CLK4 0 -1.070 0.840
NEK4 0 1.730 -1.300
NRBP1 0 -1.270 2.090
PASK 0 -0.540 0.670
STK25 0 1.220 -0.770 -0.371 0.364
STK25 0 1.220 -0.770 -0.052
PRKD3 0 0.160 0.030
PRKD3 0 0.160 0.030
AAK1 0 1.900 -1.150
AAK1 0 1.900 -1.150 0.289 -0.421
MARK1 0 -1.135
CDK18 0 0.240 0.140
CDK18 0 0.240 0.140
NEK2 0 -0.540 0.300
RPS6KA1 0 -0.160 -0.660
RPS6KA1 0 -0.160 -0.660
STK11 0
NEK6 0 0.580 -1.160
NEK9 0 1.890 -1.000
MASTL 0 0.400 -0.110 -0.766 0.090
PKN1 0 -1.000 1.540 -0.016
CDK2 0 -0.040 -0.300 -0.578 -0.797
CDK2 0 -0.040 -0.300 -0.202 -0.884 -0.107 -0.097 -0.501
RIOK1 0 0.751 -0.019
MAP2K2 0 -0.610 0.080
MAP2K2 0 -0.610 0.080
PKMYT1 0 -0.470 0.850
KDR 0 0.860 -0.680
EIF2AK4 0 -0.850 1.010
PAK4 0 -0.700 0.980 0.206 -0.937
LATS1 0 0.520 -0.880
PRKAA1 0 0.910 0.060
DSTYK 0 -0.380 0.470
DCLK1 0 -1.340 1.710
DCLK1 0 -1.340 1.710
EPHB2 0 -0.630 0.780 0.221
EPHB2 0 -0.630 0.780
CSNK1G2 0 -0.520 0.560 -0.583 0.273
CAMK1 0 1.160 -0.740
ROCK2 0 -1.660 2.330
TAOK3 0 -0.440 0.370
TAOK3 0 -0.440 0.370 1.169
SRPK2 0 -0.090 0.510 -0.634
MAP3K7 0 -1.120 1.140 -1.048
CDK4 0 1.930 -0.950
CDK4 0 1.930 -0.950 -0.510 0.013
ACVR1B 0 -0.720 1.030
SCYL2 0 0.190 0.660 -1.737 -0.391 -0.661 -1.365 -0.253
NEK3 0 -0.080 -0.100
RIPK1 0 -0.190 0.440
CDK15 0 0.260 -0.940 -0.510 0.013
BMPR1B 0 -0.810 0.900
PDPK1 0 0.050 -0.440
KSR1 0 0.100 0.600
MINK1 0 -0.710 0.650 0.038 0.092 0.062
MINK1 0 -0.710 0.650
CSNK1D 0 0.340 -0.060 0.150 0.527
CSNK1D 0 0.340 -0.060
CSNK1D 0 0.340 -0.060 1.237 -0.682 -0.148
ERBB2 0 -1.310 1.360
SIK1 0 0.130 -0.480
SCYL1 0 0.410 -0.530 0.944
AKT1 0 -0.050 0.700
AKT1 0 0.860 -0.040
EPHA2 0 1.330 -0.460 0.221
MAP3K6 0 0.420 -0.050
PRKACB 0 1.740 -1.200 -1.064
PRKACB 0 1.740 -1.200 -1.005 -0.697 0.234 0.487
ABL2 0 0.050 -0.340
CDC42BPA 0 0.270 -0.540 0.369 0.295
EPHA5 0 -0.280 0.790
TBCK 0 1.920 -1.100
CAMK2D 0 -0.260 0.500 -0.654 0.073
CAMK2D 0 -0.260 0.500 -0.619 0.544 0.125
CAMK2D 0 -0.260 0.500
PLK2 0 0.900 -0.790
EGFR 0 -0.580 0.520 0.513 0.090
TLK2 0 -0.170 -0.340 0.092
PAK1 0 1.190 -0.630
TAOK2 0 -0.120 -0.070 1.017 -0.645
TAOK2 0 0.700 -0.640 1.017 -0.645
TAOK2 0 -0.120 -0.070
TAOK2 0 0.700 -0.640
CSNK1G3 0 -0.480 0.480 -0.583 0.273
FER 0 0.540 -0.510 0.407
UHMK1 0 -1.130 2.350
CAMK4 0 0.780 -0.790
MERTK 0 -0.060 0.240
PRKCA 0 0.750 -0.690 0.349 0.585
PRKCA 0 0.750 -0.690
OBSCN 0 -0.680 0.510
OBSCN 0 -0.170 0.030
OBSCN 0 1.520 -0.830
EPHB1 0 -0.220 0.000 0.221
EPHB1 0 -0.220 0.000 -0.042
EPHB1 0 -0.220 0.000
CDK20 0 -0.940 0.420
PHKG2 0 -0.370 -0.400
PHKG2 0 -0.350 -0.370
DYRK1A 0 -1.360 2.390
BRAF 0
PKN3 0
BRSK1 0 0.330 -0.040
PRKAA2 0 -0.030 -0.350
PRKAA2 0 -0.030 -0.350
JAK1 0 0.190 -0.100 -1.504 -0.381 -0.438
HIPK1 0 1.760 -0.820
PRKCI 0 0.730 -0.460 1.483 0.192 0.350
RYK 0 0.020 0.190
SNRK 0 0.660 -0.170
PRKCD 0 0.250 0.070 0.578 0.427
CDK5 0 -1.100 1.740 -0.236 1.063 0.312
WNK2 0 -0.660 0.130
MELK 0 -0.620 0.710 -0.249 -0.278
PRKCB 0 0.260 -0.530
PRKCB 0 0.260 -0.530 0.349 0.585
CDK12 0 1.020 -0.690 -0.510 0.013
PBK 0 0.280 -0.180
ROR2 0 0.180 -0.350
BUB1 0 -0.530 0.350
BUB1 0 -0.530 0.350
MAP3K2 0 -1.220 1.960
CDK1 0 -0.370 0.080 -0.202 -0.884 -0.107 -0.097 -0.501
EIF2AK3 0 0.010 0.340
TP53RK 0 1.015
ADRBK1 0 -0.390 0.360
ADRBK1 0 -0.340 0.480
TRIB1 0 -0.220 -0.430
BRSK2 0 1.070 -0.640
RPS6KB2 0 -1.260 2.030
YES1 0 0.340 -0.470 0.295 0.576
ULK1 0 0.740 -0.520
GSG2 0 1.490 -0.810
ERBB4 0
ERBB4 0
GAK 0 1.140 -0.180 0.248
AURKB 0 -0.840 1.170 -0.562 -0.744 -0.302
CLK3 0 0.000 0.270 1.140 0.556 0.830
CLK3 0 0.000 0.270
PAK2 0 -0.760 1.040
AATK 0 -0.220 0.730 0.624 -1.011
EPHB3 0 0.800 -0.380 0.221
EPHB3 0 0.800 -0.380
LCK 0 -0.490 1.390 0.295 0.576
PRKD1 0 1.050 0.130
PRKD1 0 1.050 0.130
PRKD1 0 1.050 0.130
POMK 0 0.330 -0.200
LRRK2 0 0.530 -0.620 -0.240
EPHB4 0 1.130 -1.030
DAPK1 0 -0.090 -0.480 -1.111
SRC 0 0.050 0.470 -0.031
MAP3K5 0 0.710 -0.770
PIM3 0 0.860 -0.790
TLK1 0 1.190 -1.120
STK39 0 1.920 -1.010
CDC42BPB 0 -1.290 1.790 0.546 0.645 0.683
MAP3K3 0 0.830 -0.050
STK38L 0 -1.050 1.050 -1.472 -0.993 0.116
CHUK 0 -0.480
CSNK1E 0 -0.170 -0.440 0.150 0.527
CSNK1E 0 -0.170 -0.440 1.237 -0.682 -0.148
CDK3 0 -1.270 2.210 -0.578 -0.797
STRADA 0

PTM Sites:

Back to Protein Results
Gene name PTM type PTM site UV UV (MG132) Sequence
AAK1 Phosphorylation T605 -0.689 _VQT(ph)TPPPAVQGQK_
AAK1 Phosphorylation T606 -0.648 -1.206 _VQTT(ph)PPPAVQGQK_
AAK1 Phosphorylation T620 -0.540 -0.524 _VGSLT(ph)PPSS(ph)PK_
AAK1 Phosphorylation S623 -0.540 -0.550 _VGSLT(ph)PPS(ph)SPK_
AAK1 Phosphorylation S624 -0.737 -0.516 _VGSLT(ph)PPSS(ph)PK_
AAK1 Phosphorylation S652 0.769 1.397 _S(ph)TQLLQAAAAEASLNK_
AAK1 Phosphorylation T653 0.769 1.397 _S(ph)TQLLQAAAAEASLNK_
AAK1 Phosphorylation S947 -0.044 0.120 _S(ph)ESNEDLFGLVPFDEITGSQQQK_
AAK1 Phosphorylation S949 0.168 -0.189 _SES(ph)NEDLFGLVPFDEITGSQQQK_
AAK1 Phosphorylation T1014 -0.576 0.108 _TLKPTYRT(ph)PER_
ABL1 Phosphorylation S1083 -1.131 -0.857 _GQGESDPLDHEPAVS(ph)PLLPR_
ABL1 Phosphorylation S1134 0.293 _SSS(ph)FREMDGQPER_
ABL1 Phosphorylation S1232 0.821 0.183 _SCS(ph)ASCVPHGAK_
ABL2 Phosphorylation S618 -0.733 _GAQASS(ph)GSPALPR_
ABL2 Phosphorylation S620 0.568 0.091 _GAQASSGS(ph)PALPR_
ABL2 Phosphorylation S631 0.529 0.416 _DKS(ph)PSSLLEDAK_
ABL2 Phosphorylation S634 0.322 _DKSPSS(ph)LLEDAK_
ABL2 Phosphorylation S781 0.421 _S(ph)NSTSSM(ox)SSGLPEQDR_
ABL2 Phosphorylation S783 -0.171 _SNS(ph)TSSMSSGLPEQDR_
ABL2 Phosphorylation S817 0.028 0.055 _TVS(ph)TSSQPEENVDR_
ABL2 Phosphorylation S936 -0.218 -0.547 _VPVLIS(ph)PTLK_
ACVR1B Ubiquitylation K215 0.000 _TIVLQEIIGK(gl)GR_
ADRBK1 Phosphorylation S670 1.038 0.924 _NKPRS(ph)PVVELSK_
ADRBK1 Phosphorylation S676 1.113 _NKPRSPVVELS(ph)K_
AKT1 Phosphorylation S124 0.252 0.311 _SGS(ph)PSDNSGAEEMEVSLAKPK_
AKT1 Phosphorylation S126 -0.241 _SGSPS(ph)DNSGAEEM(ox)EVSLAK_
AKT1 Ubiquitylation K301 0.988 _EGIK(gl)DGATMK_
AKT2 Ubiquitylation K14 0.306 0.070 _EGWLHK(gl)R_
AKT2 Ubiquitylation K111 1.082 _AIQMVANSLK(gl)QR_
AKT2 Ubiquitylation K160 0.251 _LLGK(gl)GTFGK_
AKT2 Phosphorylation T451 -0.091 -0.612 _YFDDEFTAQSITIT(ph)PPDRYDSLGLLELDQR_
AKT2 Phosphorylation Y456 -0.265 _YFDDEFTAQSITITPPDRY(ph)DSLGLLELDQR_
AKT3 Ubiquitylation K14 0.306 0.070 _EGWLHK(gl)R_
AKT3 Ubiquitylation K14 4.941 5.277 _EGWVQK(gl)R_
AKT3 Ubiquitylation K111 1.082 _AIQMVANSLK(gl)QR_
AKT3 Phosphorylation S120 1.097 _MNCS(ph)PTSQIDNIGEEEMDASTTHHK_
AKT3 Ubiquitylation K160 0.251 _LLGK(gl)GTFGK_
AKT3 Phosphorylation T451 -0.091 -0.612 _YFDDEFTAQSITIT(ph)PPDRYDSLGLLELDQR_
AKT3 Phosphorylation Y456 -0.265 _YFDDEFTAQSITITPPDRY(ph)DSLGLLELDQR_
ARAF Phosphorylation T227 0.017 _STSTPNVHMVSTT(ph)APMDSNLIQLTGQSFSTDAAGSR_
ARAF Phosphorylation S260 0.245 _GS(ph)PSPASVSSGR_
ARAF Ubiquitylation K543 -1.068 -0.962 _ISSNCPK(gl)AMR_
ARAF Phosphorylation S621 0.212 0.271 _SAS(ph)EPSLHR_
AURKB Ubiquitylation K56 -2.018 -2.920 _SNVQPTAAPGQK(gl)VMENSSGTPDILTR_
AURKB Ubiquitylation K87 -0.700 -1.401 _GK(gl)FGNVYLAR_
AURKB Ubiquitylation K164 -1.041 _GELYK(gl)ELQK_
AURKB Ubiquitylation K168 -0.421 -1.027 _ELQK(gl)SCTFDEQR_
AURKB Ubiquitylation K287 -0.625 _IVK(gl)VDLK_
BMP2K Phosphorylation S947 -0.044 0.120 _S(ph)ESNEDLFGLVPFDEITGSQQQK_
BMP2K Phosphorylation S949 0.168 -0.189 _SES(ph)NEDLFGLVPFDEITGSQQQK_
BMP2K Phosphorylation T1014 -0.576 0.108 _TLKPTYRT(ph)PER_
BMPR1A Ubiquitylation K232 -0.391 0.172 _TIAK(gl)QIQMVR_
BMPR1A Ubiquitylation K477 0.265 -0.134 _EVVCVK(gl)R_
BMPR1B Ubiquitylation K477 1.033 _EIVCIK(gl)K_
BRAF Phosphorylation S151 -0.685 -0.629 _SNPKS(ph)PQKPIVR_
BRAF Phosphorylation S363 -0.023 -0.241 _S(ph)SSAPNVHINTIEPVNIDDLIR_
BRAF Phosphorylation S365 -0.286 0.012 _SSS(ph)APNVHINTIEPVNIDDLIR_
BRAF Phosphorylation S399 -0.890 -0.527 _GDGGSTTGLS(ph)ATPPASLPGSLTNVK_
BRAF Phosphorylation T401 -0.525 _GDGGSTTGLSAT(ph)PPASLPGSLTNVK_
BRAF Phosphorylation S446 0.246 0.349 _RDS(ph)SDDWEIPDGQITVGQR_
BRAF Phosphorylation S447 0.579 0.623 _RDSS(ph)DDWEIPDGQITVGQR_
BRAF Phosphorylation S729 0.208 0.219 _SAS(ph)EPSLNR_
BRSK1 Phosphorylation S489 -0.354 -0.198 _NSFLGS(ph)PR_
BRSK2 Phosphorylation S294 0.075 _SLPS(ph)LEDIDPDVLDSMHSLGCFR_
BRSK2 Phosphorylation S382 0.812 -1.070 _S(ph)MEVLSVTDGGSPVPAR_
BRSK2 Phosphorylation S393 -0.463 -1.217 _S(ph)M(ox)EVLSVTDGGS(ph)PVPAR_
BRSK2 Phosphorylation S423 -0.553 -0.633 _SISGASSGLSTS(ph)PLSSPR_
BRSK2 Phosphorylation S489 -0.354 -0.198 _NSFLGS(ph)PR_
BUB1 Ubiquitylation K203 -1.190 _NQGSELSGVISSACDK(gl)ESNMER_
BUB1 Phosphorylation S596 0.682 _S(ph)PGDFTSAAQLASTPFHK_
BUB1 Phosphorylation S655 0.296 0.593 _DGKFS(ph)PIQEK_
BUB1B Ubiquitylation K438 -0.825 _EAELLTSAEK(gl)R_
BUB1B Ubiquitylation K475 -0.386 _TGDQQEETMPTK(gl)ETTK_
BUB1B Phosphorylation S543 -0.522 -0.173 _NKS(ph)PPADPPR_
BUB1B Phosphorylation S670 0.830 0.911 _LS(ph)PIIEDSR_
CAMK1 Ubiquitylation K49 -0.158 _LVAIK(gl)CIAK_
CAMK2A Ubiquitylation K251 -0.437 _DLINK(gl)MLTINPAK_
CAMK2B Ubiquitylation K147 -1.064 _DLKPENLLLASK(gl)CK_
CAMK2B Ubiquitylation K251 -0.437 _DLINK(gl)MLTINPAK_
CAMK2D Ubiquitylation K251 -0.437 _DLINK(gl)MLTINPAK_
CAMK2D Phosphorylation S330 0.412 0.370 _KPDGVKES(ph)TESSNTTIEDEDVK_
CAMK2D Phosphorylation T331 -0.174 _KPDGVKES(ph)TESSNTTIEDEDVK_
CAMK2D Phosphorylation T336 0.615 0.376 _ESTESSNT(ph)TIEDEDVK_
CAMK2D Phosphorylation T337 0.450 _ESTESSNTT(ph)IEDEDVK_
CAMK2G Ubiquitylation K147 -1.064 _DLKPENLLLASK(gl)CK_
CAMK2G Ubiquitylation K251 -0.437 _DLINK(gl)MLTINPAK_
CAMK2G Phosphorylation S365 0.765 _GSTES(ph)CNTTTEDEDLK_
CAMK4 Phosphorylation S360 -0.256 0.086 _DPS(ph)PIQDGNEDMK_
CAMKK1 Phosphorylation S74 0.752 0.924 _KLS(ph)LQER_
CAMKK1 Phosphorylation S82 -0.892 -0.705 _LSLQERPAGS(ph)YLEAQAGPYATGPASHISPR_
CAMKK1 Phosphorylation S530 0.732 0.456 _EGFGEGGKS(ph)PELPGVQEDEAAS_
CAMKK2 Phosphorylation S74 0.752 0.924 _KLS(ph)LQER_
CAMKK2 Phosphorylation S100 0.985 0.940 _KLS(ph)LQER_
CAMKK2 Phosphorylation S495 0.812 _RS(ph)FGNPFEGSR_
CAMKK2 Phosphorylation S511 0.155 _SLS(ph)APGNLLTK_
CASK Ubiquitylation K41 1.029 1.231 _ETGQQFAVK(gl)IVDVAK_
CASK Ubiquitylation K60 0.240 0.541 _FTSSPGLSTEDLK(gl)R_
CASK Phosphorylation S570 0.125 _TQSS(ph)SCEDLPSTTQPK_
CASK Phosphorylation S571 0.134 -0.032 _TQSSS(ph)CEDLPSTTQPK_
CASK Ubiquitylation K665 -0.631 _LENSK(gl)NGTAGLIPSPELQEWR_
CASK Ubiquitylation K691 1.108 _TK(gl)QEQQASCTWFGK_
CASK Ubiquitylation K703 0.627 _TKQEQQASCTWFGK(gl)K_
CASK Ubiquitylation K704 0.627 _TKQEQQASCTWFGK(gl)K_
CDC42BPA Phosphorylation S1545 0.686 _RYS(ph)FRVPEEER_
CDC42BPA Phosphorylation S1629 0.643 0.973 _SMS(ph)ASSGLSAR_
CDC42BPA Phosphorylation S1651 0.478 0.828 _EFS(ph)GGSYSAK_
CDC42BPA Phosphorylation S1721 1.103 1.216 _SLS(ph)LESTDR_
CDC42BPB Ubiquitylation K338 -0.347 _LGQNGIEDFKK(gl)_
CDC42BPB Ubiquitylation K426 0.566 _SIMQSNTLTK(gl)DEDVQR_
CDC42BPB Phosphorylation S481 0.701 0.480 _ALSNS(ph)NRDKEIK_
CDC42BPB Ubiquitylation K1337 1.400 1.105 _GCQLMATATLK(gl)R_
CDC42BPB Phosphorylation S1690 -1.711 -2.133 _HSTPSNSSNPSGPPS(ph)PNSPHR_
CDC7 Ubiquitylation K253 -1.137 _ELDQQSTTK(gl)ASVK_
CDC7 Ubiquitylation K441 -1.134 _ETIQAAK(gl)TFGK_
CDK1 Ubiquitylation K6 0.011 -0.784 _(ac)M(ox)EDYTK(gl)IEK_
CDK1 Ubiquitylation K20 -0.327 -0.270 _IGEGTYGVVYK(gl)GR_
CDK1 Ubiquitylation K33 0.736 0.239 _TTGQVVAMK(gl)K_
CDK1 Ubiquitylation K34 -0.306 _TTGQVVAMKK(gl)_
CDK1 Ubiquitylation K58 0.312 -0.262 _EISLLK(gl)ELR_
CDK1 Ubiquitylation K136 -0.468 _DLK(gl)PQNLLIDDK(gl)GTIK_
CDK1 Ubiquitylation K145 0.161 -0.954 _DLKPQNLLIDDK(gl)GTIK_
CDK1 Ubiquitylation K149 -0.038 _GTIK(gl)LADFGLAR_
CDK1 Ubiquitylation K251 -0.047 -1.236 _WK(gl)PGSLASHVK_
CDK1 Ubiquitylation K280 0.179 -1.210 _MLIYDPAK(gl)R_
CDK11A Phosphorylation S47 0.375 0.573 _RDS(ph)LEEGELR_
CDK11A Phosphorylation T61 0.721 _MEIT(ph)IRNSPYR_
CDK11A Phosphorylation S65 0.730 0.552 _MEITIRNS(ph)PYR_
CDK11A Phosphorylation S234 -0.737 -0.712 _S(ph)PPRPPR_
CDK11A Phosphorylation S283 0.324 0.483 _DLLSDLQDIS(ph)DSER_
CDK11A Ubiquitylation K467 -0.286 _TDEIVALK(gl)R_
CDK11A Phosphorylation S589 0.529 0.585 _EYGS(ph)PLKAYT(ph)PVVVTLWYR_
CDK11A Phosphorylation T595 0.472 0.397 _AYT(ph)PVVVTLWYR_
CDK11A Ubiquitylation K672 -1.465 _IWPGYSELPAVK(gl)K_
CDK11A Ubiquitylation K673 -1.465 _IWPGYSELPAVK(gl)K_
CDK11A Ubiquitylation K719 -0.672 _ISAEDGLK(gl)HEYFR_
CDK11A Phosphorylation T751 -0.349 -0.460 _RGT(ph)SPRPPEGGLGYSQLGDDDLK_
CDK11A Phosphorylation S752 -0.526 -0.643 _RGTS(ph)PRPPEGGLGYSQLGDDDLK_
CDK12 Phosphorylation S236 0.095 _QDDS(ph)PSGASYGQDYDLS(ph)PSR_
CDK12 Phosphorylation S249 0.095 _QDDS(ph)PSGASYGQDYDLS(ph)PSR_
CDK12 Phosphorylation S385 0.649 _HSSIS(ph)PVRLPLNSSLGAELSR_
CDK12 Phosphorylation S420 0.004 -0.202 _ES(ph)KGSPVFLPR_
CDK12 Phosphorylation S423 -0.155 -0.297 _GS(ph)PVFLPR_
CDK12 Phosphorylation T514 0.364 0.570 _DSKPIALKEEIVT(ph)PK_
CDK12 Phosphorylation S681 -2.532 -2.051 _HLLTDLPLPPELPGGDLS(ph)PPDS(ph)PEPK_
CDK12 Phosphorylation S685 -2.729 _HLLTDLPLPPELPGGDLS(ph)PPDS(ph)PEPK_
CDK12 Phosphorylation T692 -0.765 -1.849 _AIT(ph)PPQQPYK_
CDK12 Phosphorylation S1082 -1.661 -0.980 _KETTSGTSTEPVKNS(ph)SPAPPQPAPGK_
CDK12 Phosphorylation S1083 -1.093 -1.330 _NSS(ph)PAPPQPAPGK_
CDK12 Phosphorylation T1244 -0.956 _RT(ph)PTMPQEEAAACPPHILPPEK_
CDK13 Phosphorylation S383 -0.073 0.010 _GGDVS(ph)PSPYSSSSWR_
CDK13 Phosphorylation S493 -0.539 _ASNTS(ph)TPTKGNTETSASASQTNHVK_
CDK13 Phosphorylation T494 -0.207 _ASNTST(ph)PTKGNTETSASASQTNHVK_
CDK13 Phosphorylation S525 0.544 0.150 _IEHAPS(ph)PSSGGTLK_
CDK13 Phosphorylation S664 -0.641 _CLLADLPLPPELPGGDDLSKS(ph)PEEK_
CDK13 Phosphorylation T1246 -0.527 -0.133 _ILELT(ph)PEPDRPR_
CDK14 Phosphorylation S236 0.095 _QDDS(ph)PSGASYGQDYDLS(ph)PSR_
CDK14 Phosphorylation S249 0.095 _QDDS(ph)PSGASYGQDYDLS(ph)PSR_
CDK14 Phosphorylation S385 0.649 _HSSIS(ph)PVRLPLNSSLGAELSR_
CDK14 Phosphorylation S420 0.004 -0.202 _ES(ph)KGSPVFLPR_
CDK14 Phosphorylation S423 -0.155 -0.297 _GS(ph)PVFLPR_
CDK14 Phosphorylation T514 0.364 0.570 _DSKPIALKEEIVT(ph)PK_
CDK14 Phosphorylation S681 -2.532 -2.051 _HLLTDLPLPPELPGGDLS(ph)PPDS(ph)PEPK_
CDK14 Phosphorylation S685 -2.729 _HLLTDLPLPPELPGGDLS(ph)PPDS(ph)PEPK_
CDK14 Phosphorylation T692 -0.765 -1.849 _AIT(ph)PPQQPYK_
CDK14 Phosphorylation S1082 -1.661 -0.980 _KETTSGTSTEPVKNS(ph)SPAPPQPAPGK_
CDK14 Phosphorylation S1083 -1.093 -1.330 _NSS(ph)PAPPQPAPGK_
CDK14 Phosphorylation T1244 -0.956 _RT(ph)PTMPQEEAAACPPHILPPEK_
CDK15 Phosphorylation S236 0.095 _QDDS(ph)PSGASYGQDYDLS(ph)PSR_
CDK15 Phosphorylation S249 0.095 _QDDS(ph)PSGASYGQDYDLS(ph)PSR_
CDK15 Phosphorylation S385 0.649 _HSSIS(ph)PVRLPLNSSLGAELSR_
CDK15 Phosphorylation S420 0.004 -0.202 _ES(ph)KGSPVFLPR_
CDK15 Phosphorylation S423 -0.155 -0.297 _GS(ph)PVFLPR_
CDK15 Phosphorylation T514 0.364 0.570 _DSKPIALKEEIVT(ph)PK_
CDK15 Phosphorylation S681 -2.532 -2.051 _HLLTDLPLPPELPGGDLS(ph)PPDS(ph)PEPK_
CDK15 Phosphorylation S685 -2.729 _HLLTDLPLPPELPGGDLS(ph)PPDS(ph)PEPK_
CDK15 Phosphorylation T692 -0.765 -1.849 _AIT(ph)PPQQPYK_
CDK15 Phosphorylation S1082 -1.661 -0.980 _KETTSGTSTEPVKNS(ph)SPAPPQPAPGK_
CDK15 Phosphorylation S1083 -1.093 -1.330 _NSS(ph)PAPPQPAPGK_
CDK15 Phosphorylation T1244 -0.956 _RT(ph)PTMPQEEAAACPPHILPPEK_
CDK16 Phosphorylation S110 0.566 _RQLS(ph)MTLR_
CDK16 Phosphorylation S176 -0.089 -0.530 _M(ox)GS(ph)DGESDQASATSSDEVQS(ph)PVR_
CDK16 Phosphorylation S193 -0.305 -0.461 _MGS(ph)DGESDQASATSSDEVQS(ph)PVR_
CDK16 Phosphorylation S208 0.508 0.023 _KIS(ph)TEDINK_
CDK16 Phosphorylation T209 0.502 _KIS(ph)TEDINKR_
CDK16 Phosphorylation S217 -0.051 0.003 _RLS(ph)LPADIR_
CDK16 Phosphorylation S236 -0.603 -0.685 _LTLNS(ph)PIFDKPLSR_
CDK16 Phosphorylation S236 0.095 _QDDS(ph)PSGASYGQDYDLS(ph)PSR_
CDK16 Ubiquitylation K243 0.512 _EVSLLK(gl)DLK_
CDK16 Phosphorylation S249 0.095 _QDDS(ph)PSGASYGQDYDLS(ph)PSR_
CDK16 Phosphorylation S251 0.931 0.143 _RVS(ph)LSEIGFGK_
CDK16 Phosphorylation S253 -0.670 _RVSLS(ph)EIGFGK_
CDK16 Phosphorylation S385 0.649 _HSSIS(ph)PVRLPLNSSLGAELSR_
CDK16 Phosphorylation S420 0.004 -0.202 _ES(ph)KGSPVFLPR_
CDK16 Phosphorylation S423 -0.155 -0.297 _GS(ph)PVFLPR_
CDK16 Phosphorylation T514 0.364 0.570 _DSKPIALKEEIVT(ph)PK_
CDK16 Phosphorylation S681 -2.532 -2.051 _HLLTDLPLPPELPGGDLS(ph)PPDS(ph)PEPK_
CDK16 Phosphorylation S685 -2.729 _HLLTDLPLPPELPGGDLS(ph)PPDS(ph)PEPK_
CDK16 Phosphorylation T692 -0.765 -1.849 _AIT(ph)PPQQPYK_
CDK16 Phosphorylation S1082 -1.661 -0.980 _KETTSGTSTEPVKNS(ph)SPAPPQPAPGK_
CDK16 Phosphorylation S1083 -1.093 -1.330 _NSS(ph)PAPPQPAPGK_
CDK16 Phosphorylation T1244 -0.956 _RT(ph)PTMPQEEAAACPPHILPPEK_
CDK17 Phosphorylation S9 0.208 0.548 _RLS(ph)LTLR_
CDK17 Phosphorylation S122 0.269 _M(ox)GSDGESDQASGTSSDEVQS(ph)PTGVCLR_
CDK17 Phosphorylation S137 0.529 0.540 _RIS(ph)MEDLNK_
CDK17 Ubiquitylation K143 0.747 _ISMEDLNK(gl)R_
CDK17 Phosphorylation S146 -0.051 0.013 _RLS(ph)LPADIR_
CDK17 Phosphorylation S165 0.398 _LQINS(ph)PPFDQPMSR_
CDK17 Phosphorylation S180 0.603 0.218 _RAS(ph)LSEIGFGK_
CDK17 Ubiquitylation K212 -0.028 _SK(gl)LTENLVALK_
CDK17 Ubiquitylation K221 0.400 _LTENLVALK(gl)EIR_
CDK17 Phosphorylation S236 0.095 _QDDS(ph)PSGASYGQDYDLS(ph)PSR_
CDK17 Ubiquitylation K243 0.512 _EVSLLK(gl)DLK_
CDK17 Phosphorylation S249 0.095 _QDDS(ph)PSGASYGQDYDLS(ph)PSR_
CDK17 Phosphorylation S385 0.649 _HSSIS(ph)PVRLPLNSSLGAELSR_
CDK17 Phosphorylation S420 0.004 -0.202 _ES(ph)KGSPVFLPR_
CDK17 Phosphorylation S423 -0.155 -0.297 _GS(ph)PVFLPR_
CDK17 Ubiquitylation K499 -0.062 _EIQLQK(gl)DPGFR_
CDK17 Phosphorylation T514 0.364 0.570 _DSKPIALKEEIVT(ph)PK_
CDK17 Phosphorylation S681 -2.532 -2.051 _HLLTDLPLPPELPGGDLS(ph)PPDS(ph)PEPK_
CDK17 Phosphorylation S685 -2.729 _HLLTDLPLPPELPGGDLS(ph)PPDS(ph)PEPK_
CDK17 Phosphorylation T692 -0.765 -1.849 _AIT(ph)PPQQPYK_
CDK17 Phosphorylation S1082 -1.661 -0.980 _KETTSGTSTEPVKNS(ph)SPAPPQPAPGK_
CDK17 Phosphorylation S1083 -1.093 -1.330 _NSS(ph)PAPPQPAPGK_
CDK17 Phosphorylation T1244 -0.956 _RT(ph)PTMPQEEAAACPPHILPPEK_
CDK18 Phosphorylation S12 0.169 0.071 _RFS(ph)LSVPR_
CDK18 Phosphorylation S72 -1.257 _DPPQECSTFSPTDSGEEPGQLS(ph)PGVQFQR_
CDK18 Phosphorylation S87 0.561 _RFS(ph)MEDVSK_
CDK18 Phosphorylation S96 0.155 _RLS(ph)LPMDIR_
CDK18 Phosphorylation S130 0.568 0.506 _RAS(ph)LSDIGFGK_
CDK18 Phosphorylation S132 0.615 0.596 _RASLS(ph)DIGFGK_
CDK18 Ubiquitylation K212 -0.028 _SK(gl)LTENLVALK_
CDK18 Ubiquitylation K221 0.400 _LTENLVALK(gl)EIR_
CDK2 Ubiquitylation K6 -0.130 -0.399 _(ac)MENFQK(gl)VEK_
CDK2 Ubiquitylation K6 0.011 -0.784 _(ac)M(ox)EDYTK(gl)IEK_
CDK2 Phosphorylation T14 0.429 _IGEGT(ph)YGVVYK_
CDK2 Phosphorylation Y15 0.697 0.743 _IGEGTY(ph)GVVYK_
CDK2 Ubiquitylation K20 0.272 _IGEGTYGVVYK(gl)AR_
CDK2 Ubiquitylation K20 -0.327 -0.270 _IGEGTYGVVYK(gl)GR_
CDK2 Ubiquitylation K24 0.366 _NK(gl)LTGEVVALKK_
CDK2 Ubiquitylation K33 0.033 _NKLTGEVVALK(gl)K_
CDK2 Ubiquitylation K33 0.736 0.239 _TTGQVVAMK(gl)K_
CDK2 Ubiquitylation K34 0.542 _LTGEVVALKK(gl)_
CDK2 Ubiquitylation K34 -0.306 _TTGQVVAMKK(gl)_
CDK2 Ubiquitylation K58 0.312 -0.262 _EISLLK(gl)ELR_
CDK2 Ubiquitylation K136 -0.468 _DLK(gl)PQNLLIDDK(gl)GTIK_
CDK2 Ubiquitylation K145 0.161 -0.954 _DLKPQNLLIDDK(gl)GTIK_
CDK2 Ubiquitylation K149 -0.038 _GTIK(gl)LADFGLAR_
CDK2 Ubiquitylation K251 -0.047 -1.236 _WK(gl)PGSLASHVK_
CDK2 Ubiquitylation K280 0.179 -1.210 _MLIYDPAK(gl)R_
CDK2 Ubiquitylation K298 -1.907 -2.380 _QDFSK(gl)VVPPLDEDGR_
CDK20 Ubiquitylation K20 0.300 _IGEGAHGIVFK(gl)AK_
CDK3 Ubiquitylation K6 -0.130 -0.399 _(ac)MENFQK(gl)VEK_
CDK3 Phosphorylation T14 0.429 _IGEGT(ph)YGVVYK_
CDK3 Phosphorylation Y15 0.697 0.743 _IGEGTY(ph)GVVYK_
CDK3 Ubiquitylation K20 0.272 _IGEGTYGVVYK(gl)AR_
CDK3 Ubiquitylation K24 0.366 _NK(gl)LTGEVVALKK_
CDK3 Ubiquitylation K33 0.033 _NKLTGEVVALK(gl)K_
CDK3 Ubiquitylation K34 0.542 _LTGEVVALKK(gl)_
CDK3 Ubiquitylation K298 -1.907 -2.380 _QDFSK(gl)VVPPLDEDGR_
CDK4 Ubiquitylation K142 -0.552 _DLK(gl)PENILVTSGGTVK_
CDK4 Ubiquitylation K211 -0.101 _K(gl)PLFCGNSEADQLGK_
CDK4 Phosphorylation S236 0.095 _QDDS(ph)PSGASYGQDYDLS(ph)PSR_
CDK4 Phosphorylation S249 0.095 _QDDS(ph)PSGASYGQDYDLS(ph)PSR_
CDK4 Ubiquitylation K297 0.247 0.052 _ALQHSYLHK(gl)DEGNPE_
CDK4 Phosphorylation S385 0.649 _HSSIS(ph)PVRLPLNSSLGAELSR_
CDK4 Phosphorylation S420 0.004 -0.202 _ES(ph)KGSPVFLPR_
CDK4 Phosphorylation S423 -0.155 -0.297 _GS(ph)PVFLPR_
CDK4 Phosphorylation T514 0.364 0.570 _DSKPIALKEEIVT(ph)PK_
CDK4 Phosphorylation S681 -2.532 -2.051 _HLLTDLPLPPELPGGDLS(ph)PPDS(ph)PEPK_
CDK4 Phosphorylation S685 -2.729 _HLLTDLPLPPELPGGDLS(ph)PPDS(ph)PEPK_
CDK4 Phosphorylation T692 -0.765 -1.849 _AIT(ph)PPQQPYK_
CDK4 Phosphorylation S1082 -1.661 -0.980 _KETTSGTSTEPVKNS(ph)SPAPPQPAPGK_
CDK4 Phosphorylation S1083 -1.093 -1.330 _NSS(ph)PAPPQPAPGK_
CDK4 Phosphorylation T1244 -0.956 _RT(ph)PTMPQEEAAACPPHILPPEK_
CDK5 Ubiquitylation K56 0.606 0.237 _EICLLK(gl)ELK_
CDK6 Ubiquitylation K3 0.121 0.039 _(ac)MEK(gl)DGLCR_
CDK6 Phosphorylation S236 0.095 _QDDS(ph)PSGASYGQDYDLS(ph)PSR_
CDK6 Phosphorylation S249 0.095 _QDDS(ph)PSGASYGQDYDLS(ph)PSR_
CDK6 Phosphorylation S385 0.649 _HSSIS(ph)PVRLPLNSSLGAELSR_
CDK6 Phosphorylation S420 0.004 -0.202 _ES(ph)KGSPVFLPR_
CDK6 Phosphorylation S423 -0.155 -0.297 _GS(ph)PVFLPR_
CDK6 Phosphorylation T514 0.364 0.570 _DSKPIALKEEIVT(ph)PK_
CDK6 Phosphorylation S681 -2.532 -2.051 _HLLTDLPLPPELPGGDLS(ph)PPDS(ph)PEPK_
CDK6 Phosphorylation S685 -2.729 _HLLTDLPLPPELPGGDLS(ph)PPDS(ph)PEPK_
CDK6 Phosphorylation T692 -0.765 -1.849 _AIT(ph)PPQQPYK_
CDK6 Phosphorylation S1082 -1.661 -0.980 _KETTSGTSTEPVKNS(ph)SPAPPQPAPGK_
CDK6 Phosphorylation S1083 -1.093 -1.330 _NSS(ph)PAPPQPAPGK_
CDK6 Phosphorylation T1244 -0.956 _RT(ph)PTMPQEEAAACPPHILPPEK_
CDK9 Ubiquitylation K35 -0.042 _IGQGTFGEVFK(gl)AR_
CDK9 Ubiquitylation K151 -0.345 _DMK(gl)AANVLITR_
CDK9 Ubiquitylation K178 -0.409 -1.058 _AFSLAK(gl)NSQPNR_
CDK9 Ubiquitylation K269 -1.874 _LELVK(gl)GQK_
CDKL1 Ubiquitylation K33 -0.187 _DTGQIVAIK(gl)K_
CDKL1 Ubiquitylation K34 -0.187 _DTGQIVAIK(gl)K_
CHEK1 Ubiquitylation K53 0.879 _AVDCPENIK(gl)K_
CHEK1 Ubiquitylation K54 0.738 _AVDCPENIKK(gl)_
CHEK1 Phosphorylation S296 -0.098 0.184 _VTS(ph)GGVSESPSGFSK_
CHEK1 Phosphorylation S300 1.091 _VTSGGVS(ph)ESPSGFSK_
CHEK1 Phosphorylation S302 1.750 _VTSGGVSES(ph)PSGFSK_
CHEK1 Phosphorylation S317 1.903 _HIQSNLDFS(ph)PVNSASSEENVK_
CHEK1 Ubiquitylation K399 -0.582 _ETCEK(gl)LGYQWK_
CHEK2 Phosphorylation S260 3.670 3.632 _KFAIGS(ph)AR_
CHEK2 Ubiquitylation K437 -0.826 _TQVSLK(gl)DQITSGK_
CHUK Ubiquitylation K296 -1.637 _GGPVDLTLK(gl)QPR_
CIT Phosphorylation S440 0.108 -0.025 _SESVVSGLDS(ph)PAK_
CIT Phosphorylation S1940 -2.591 _VASS(ph)PAPPEGPSHPR_
CIT Phosphorylation S1971 0.032 _DKS(ph)PGRPLER_
CLK3 Phosphorylation S157 -0.522 -0.435 _S(ph)PEPDPYLSYR_
CLK3 Phosphorylation Y163 -0.111 _YRSPEPDPY(ph)LSYR_
CLK3 Ubiquitylation K328 -0.697 _GK(gl)SQVALK_
CLK3 Ubiquitylation K460 -1.413 _SVK(gl)NTSIR_
CLK4 Phosphorylation S138 0.559 _S(ph)IEDDEEGHLICQSGDVLR_
CSK Ubiquitylation K196 -0.133 _SGWALNMKELK(gl)_
CSNK1A1 Ubiquitylation K8 -0.342 -0.408 _(ac)ASSSGSK(gl)AEFIVGGK_
CSNK1A1 Ubiquitylation K18 0.772 _AEFIVGGKYK(gl)_
CSNK1A1 Ubiquitylation K225 0.039 0.502 _TSLPWQGLK(gl)AATK_
CSNK1A1 Ubiquitylation K304 -0.489 0.015 _QK(gl)AAQQAASSSGQGQQAQTPTGK_
CSNK1A1L Ubiquitylation K8 -0.342 -0.408 _(ac)ASSSGSK(gl)AEFIVGGK_
CSNK1A1L Ubiquitylation K18 0.772 _AEFIVGGKYK(gl)_
CSNK1A1L Ubiquitylation K225 0.039 0.502 _TSLPWQGLK(gl)AATK_
CSNK1A1L Ubiquitylation K304 -0.489 0.015 _QK(gl)AAQQAASSSGQGQQAQTPTGK_
CSNK1D Ubiquitylation K43 -1.168 _LECVK(gl)TK_
CSNK1D Ubiquitylation K45 -1.168 _LECVK(gl)TK_
CSNK1D Ubiquitylation K140 -0.969 _DVKPDNFLMGLGK(gl)K_
CSNK1D Ubiquitylation K141 -0.969 -0.720 _DVKPDNFLMGLGKK(gl)_
CSNK1D Phosphorylation S350 -0.790 _LRGTQEVAPPTPLTPTS(ph)HTANTSPRPVSGM(ox)ER_
CSNK1D Phosphorylation S363 -0.662 -0.352 _IQPAGNTS(ph)PR_
CSNK1D Phosphorylation S382 -0.647 -0.568 _GAPVNIS(ph)SSDLTGR_
CSNK1D Phosphorylation S389 0.394 0.817 _GAPANVS(ph)SSDLTGR_
CSNK1E Ubiquitylation K43 -1.168 _LECVK(gl)TK_
CSNK1E Ubiquitylation K45 -1.168 _LECVK(gl)TK_
CSNK1E Ubiquitylation K140 -0.969 _DVKPDNFLMGLGK(gl)K_
CSNK1E Ubiquitylation K141 -0.969 -0.720 _DVKPDNFLMGLGKK(gl)_
CSNK1E Phosphorylation S363 -0.662 -0.352 _IQPAGNTS(ph)PR_
CSNK1E Phosphorylation S389 0.394 0.817 _GAPANVS(ph)SSDLTGR_
CSNK1G1 Ubiquitylation K48 -0.536 _K(gl)IGCGNFGELR_
CSNK1G1 Ubiquitylation K198 -0.394 _EYIDPETK(gl)K_
CSNK1G1 Ubiquitylation K199 -0.394 _EYIDPETK(gl)K_
CSNK1G1 Ubiquitylation K253 0.276 0.386 _GSLPWQGLK(gl)ADTLK_
CSNK1G2 Ubiquitylation K48 -0.536 _K(gl)IGCGNFGELR_
CSNK1G2 Ubiquitylation K198 -0.394 _EYIDPETK(gl)K_
CSNK1G2 Ubiquitylation K199 -0.394 _EYIDPETK(gl)K_
CSNK1G2 Ubiquitylation K253 0.276 0.386 _GSLPWQGLK(gl)ADTLK_
CSNK1G3 Ubiquitylation K48 -0.536 _K(gl)IGCGNFGELR_
CSNK1G3 Ubiquitylation K198 -0.394 _EYIDPETK(gl)K_
CSNK1G3 Ubiquitylation K199 -0.394 _EYIDPETK(gl)K_
CSNK1G3 Ubiquitylation K253 0.276 0.386 _GSLPWQGLK(gl)ADTLK_
CSNK2A1 Ubiquitylation K71 0.008 _ILK(gl)PVKK_
CSNK2A1 Ubiquitylation K329 -0.661 -0.889 _EAMEHPYFYTVVK(gl)DQAR_
DAPK1 Ubiquitylation K939 0.937 0.001 _LFVLDAGASGSK(gl)DMK_
DCLK1 Phosphorylation S32 0.456 0.202 _VNGLPS(ph)PTHSAHCSFYR_
DCLK1 Phosphorylation T336 -1.793 _SPSPSPT(ph)SPGSLR_
DCLK1 Phosphorylation S337 -0.893 -0.694 _SPSPSPTS(ph)PGSLR_
DCLK1 Phosphorylation S352 0.641 0.487 _SSQHGGS(ph)STSLASTK_
DCLK1 Phosphorylation S352 0.103 0.523 _DLYRPLS(ph)SDDLDSVGDSV_
DCLK1 Phosphorylation S353 0.566 _DLYRPLSS(ph)DDLDSVGDSV_
DMPK Phosphorylation S1545 0.686 _RYS(ph)FRVPEEER_
DMPK Phosphorylation S1629 0.643 0.973 _SMS(ph)ASSGLSAR_
DMPK Phosphorylation S1651 0.478 0.828 _EFS(ph)GGSYSAK_
DMPK Phosphorylation S1721 1.103 1.216 _SLS(ph)LESTDR_
DSTYK Ubiquitylation K339 0.431 _AQSMLVEQSEK(gl)LR_
DSTYK Ubiquitylation K389 -0.671 _DLQITPK(gl)R_
DSTYK Ubiquitylation K458 0.343 _EIK(gl)CCIR_
DSTYK Ubiquitylation K787 -1.141 _NVLLDK(gl)QNR_
DYRK1A Ubiquitylation K11 -0.236 _(ac)MHTGGETSACK(gl)PSSVR_
DYRK1A Phosphorylation Y321 0.876 0.924 _IYQY(ph)IQSR_
DYRK1B Phosphorylation Y321 0.876 0.924 _IYQY(ph)IQSR_
EGFR Phosphorylation T693 0.486 -0.139 _ELVEPLT(ph)PSGEAPNQALLR_
EGFR Phosphorylation S991 -0.041 _MHLPS(ph)PTDSNFYR_
EIF2AK1 Phosphorylation S253 0.026 _AAIELPS(ph)LEVLSDQEEDREQCGVK_
EIF2AK1 Phosphorylation S258 -0.119 -0.172 _AAIELPSLEVLS(ph)DQEEDREQCGVK_
EIF2AK2 Phosphorylation S83 0.256 _KAVS(ph)PLLLTTTNSSEGLSMGNYIGLINR_
EIF2AK3 Phosphorylation S715 0.832 _EHIEIIAPS(ph)PQR_
EIF2AK4 Ubiquitylation K619 0.596 _LDGCCYAVK(gl)R_
EIF2AK4 Phosphorylation T667 -1.139 -1.215 _HERPAGPGT(ph)PPPDSGPLAK_
EIF2AK4 Ubiquitylation K1135 0.142 _NNILNLK(gl)R_
EPHA2 Ubiquitylation K578 -0.752 -0.618 _QSPEDVYFSK(gl)SEQLKPLK_
EPHA2 Ubiquitylation K583 0.445 0.124 _SEQLK(gl)PLK_
EPHA2 Ubiquitylation K617 0.339 _QK(gl)VIGAGEFGEVYK_
EPHA2 Ubiquitylation K649 -1.219 _TLK(gl)AGYTEK_
EPHA2 Phosphorylation S897 0.000 _LPS(ph)TSGSEGVPFR_
EPHA2 Phosphorylation T898 -0.329 0.424 _LPST(ph)SGSEGVPFR_
EPHA5 Ubiquitylation K657 0.533 _LKLPGK(gl)R_
EPHA6 Ubiquitylation K578 -0.752 -0.618 _QSPEDVYFSK(gl)SEQLKPLK_
EPHA6 Ubiquitylation K583 0.445 0.124 _SEQLK(gl)PLK_
EPHA6 Ubiquitylation K617 0.339 _QK(gl)VIGAGEFGEVYK_
EPHA6 Ubiquitylation K649 -1.219 _TLK(gl)AGYTEK_
EPHA6 Phosphorylation S897 0.000 _LPS(ph)TSGSEGVPFR_
EPHA6 Phosphorylation T898 -0.329 0.424 _LPST(ph)SGSEGVPFR_
EPHA7 Ubiquitylation K180 0.633 _EIGPLSKK(gl)_
EPHA7 Ubiquitylation K272 0.520 _AGYQQK(gl)GDTCEPCGR_
EPHA7 Ubiquitylation K578 -0.752 -0.618 _QSPEDVYFSK(gl)SEQLKPLK_
EPHA7 Ubiquitylation K583 0.445 0.124 _SEQLK(gl)PLK_
EPHA7 Ubiquitylation K606 -0.162 _FPGTK(gl)TYIDPETYEDPNR_
EPHA7 Ubiquitylation K617 0.339 _QK(gl)VIGAGEFGEVYK_
EPHA7 Ubiquitylation K634 0.732 1.340 _ELDASCIK(gl)IER_
EPHA7 Ubiquitylation K649 -1.219 _TLK(gl)AGYTEK_
EPHA7 Ubiquitylation K657 0.533 _LKLPGK(gl)R_
EPHA7 Ubiquitylation K665 3.196 _DVAVAIK(gl)TLK_
EPHA7 Ubiquitylation K797 -1.229 -0.459 _VIEDDPEAVYTTTGGK(gl)IPVR_
EPHA7 Phosphorylation S897 0.000 _LPS(ph)TSGSEGVPFR_
EPHA7 Phosphorylation T898 -0.329 0.424 _LPST(ph)SGSEGVPFR_
EPHA7 Phosphorylation S912 -0.413 _TPLGTCSRPIS(ph)PLLDQNTPDFTTFCSVGEWLQAIK_
EPHB1 Ubiquitylation K578 -0.752 -0.618 _QSPEDVYFSK(gl)SEQLKPLK_
EPHB1 Ubiquitylation K583 0.445 0.124 _SEQLK(gl)PLK_
EPHB1 Ubiquitylation K617 0.339 _QK(gl)VIGAGEFGEVYK_
EPHB1 Ubiquitylation K649 -1.219 _TLK(gl)AGYTEK_
EPHB1 Ubiquitylation K657 0.533 _LKLPGK(gl)R_
EPHB1 Phosphorylation S897 0.000 _LPS(ph)TSGSEGVPFR_
EPHB1 Phosphorylation T898 -0.329 0.424 _LPST(ph)SGSEGVPFR_
EPHB2 Ubiquitylation K578 -0.752 -0.618 _QSPEDVYFSK(gl)SEQLKPLK_
EPHB2 Ubiquitylation K583 0.445 0.124 _SEQLK(gl)PLK_
EPHB2 Ubiquitylation K617 0.339 _QK(gl)VIGAGEFGEVYK_
EPHB2 Ubiquitylation K649 -1.219 _TLK(gl)AGYTEK_
EPHB2 Phosphorylation S776 -0.147 -0.171 _FLEDDTS(ph)DPTYTSALGGK_
EPHB2 Phosphorylation S897 0.000 _LPS(ph)TSGSEGVPFR_
EPHB2 Phosphorylation T898 -0.329 0.424 _LPST(ph)SGSEGVPFR_
EPHB3 Ubiquitylation K578 -0.752 -0.618 _QSPEDVYFSK(gl)SEQLKPLK_
EPHB3 Ubiquitylation K583 0.445 0.124 _SEQLK(gl)PLK_
EPHB3 Ubiquitylation K617 0.339 _QK(gl)VIGAGEFGEVYK_
EPHB3 Ubiquitylation K649 -1.219 _TLK(gl)AGYTEK_
EPHB3 Phosphorylation S897 0.000 _LPS(ph)TSGSEGVPFR_
EPHB3 Phosphorylation T898 -0.329 0.424 _LPST(ph)SGSEGVPFR_
EPHB3 Ubiquitylation K960 0.133 _IGVTLAGHQKK(gl)_
EPHB4 Ubiquitylation K885 -1.394 _NPASLK(gl)IVAR_
EPHB4 Ubiquitylation K960 0.133 _IGVTLAGHQKK(gl)_
ERBB2 Ubiquitylation K200 -2.073 _ACHPCSPMCK(gl)GSR_
ERBB2 Ubiquitylation K369 -0.742 _AVTSANIQEFAGCKK(gl)_
ERBB2 Ubiquitylation K747 -0.505 -0.019 _GIWIPDGENVK(gl)IPVAIK_
ERBB2 Ubiquitylation K854 -0.859 _NVLVK(gl)SPNHVK_
ERBB2 Phosphorylation S1054 -0.476 -0.706 _S(ph)GGGDLTLGLEPSEEEAPR_
ERBB4 Ubiquitylation K714 0.078 _ILK(gl)ETELKR_
ERBB4 Ubiquitylation K745 -0.474 0.342 _GIWVPEGETVK(gl)IPVAIK_
ERBB4 Ubiquitylation K854 -0.859 _NVLVK(gl)SPNHVK_
FGFR1 Ubiquitylation K510 1.047 -0.221 _VTK(gl)VAVK_
FGFR3 Ubiquitylation K205 -0.115 _IGGIK(gl)LR_
FIP1L1 Ubiquitylation K123 -1.286 _TGAPQYGSYGTAPVNLNIK(gl)TGGR_
FIP1L1 Phosphorylation S259 -1.364 -0.698 _AEFTS(ph)PPSLFK_
FIP1L1 Phosphorylation S492 0.040 0.085 _DHS(ph)PTPSVFNSDEER_
FIP1L1 Phosphorylation T494 0.134 0.020 _DHSPT(ph)PSVFNSDEER_
FLT1 Ubiquitylation K953 -1.081 _MEPGLEQGK(gl)KPR_
FLT4 Ubiquitylation K987 -0.270 _FSK(gl)TEGGAR_
FLT4 Ubiquitylation K1064 -1.119 _DIYK(gl)DPDYVR_
FYN Ubiquitylation K13 0.286 _DKEATK(gl)LTEER_
FYN Phosphorylation S21 0.373 0.731 _DGS(ph)LNQSSGYR_
FYN Ubiquitylation K259 0.921 _LTDLSVK(gl)TK_
FYN Ubiquitylation K261 0.099 _LTDLSVKTK(gl)_
FYN Ubiquitylation K273 6.025 _SLCLEKK(gl)_
FYN Ubiquitylation K275 -0.521 _ESLQLIK(gl)R_
GSG2 Phosphorylation S143 0.253 _DS(ph)GRLSPDLSVCGQPR_
GSG2 Phosphorylation S147 0.018 0.645 _DSGRLS(ph)PDLSVCGQPR_
GSK3A Phosphorylation S9 -0.483 0.010 _TTS(ph)FAESCKPVQQPSAFGSMK_
GSK3A Phosphorylation S21 -0.406 _TSS(ph)FAEPGGGGGGGGGGPGGSASGPGGTGGGK_
GSK3A Ubiquitylation K85 -0.204 _LCDSGELVAIK(gl)K_
GSK3A Ubiquitylation K86 -0.204 _LCDSGELVAIK(gl)K_
GSK3A Ubiquitylation K148 0.396 _ELVAIK(gl)K_
GSK3A Phosphorylation S215 0.296 0.477 _GEPNVS(ph)YICSR_
GSK3A Phosphorylation Y216 0.356 0.376 _GEPNVSY(ph)ICSR_
GSK3A Phosphorylation T390 2.800 2.527 _IQAAAST(ph)PTNATAASDANTGDR_
GSK3B Phosphorylation S9 -0.483 0.010 _TTS(ph)FAESCKPVQQPSAFGSMK_
GSK3B Ubiquitylation K85 -0.204 _LCDSGELVAIK(gl)K_
GSK3B Ubiquitylation K86 -0.204 _LCDSGELVAIK(gl)K_
GSK3B Phosphorylation S215 0.296 0.477 _GEPNVS(ph)YICSR_
GSK3B Phosphorylation Y216 0.356 0.376 _GEPNVSY(ph)ICSR_
GSK3B Phosphorylation T390 2.800 2.527 _IQAAAST(ph)PTNATAASDANTGDR_
HIPK1 Ubiquitylation K492 -0.060 _YISQTQGLPAEYLLSAGTK(gl)TTR_
HIPK1 Ubiquitylation K614 -0.350 _SCFQNMEICK(gl)R_
HIPK1 Phosphorylation S1271 -0.186 _GSTIYTGYPLS(ph)PTK_
HIPK2 Ubiquitylation K492 -0.060 _YISQTQGLPAEYLLSAGTK(gl)TTR_
HIPK2 Ubiquitylation K614 -0.350 _SCFQNMEICK(gl)R_
IGF1R Ubiquitylation K47 1.146 _NDYQQLK(gl)R_
IGF1R Ubiquitylation K1033 5.779 _VAIK(gl)TVNEAASMR_
IGF1R Ubiquitylation K1168 0.191 _K(gl)GGKGLLPVR_
IGF1R Ubiquitylation K1171 0.232 _GGK(gl)GLLPVR_
IKBKB Ubiquitylation K106 0.253 _K(gl)YLNQFENCCGLR_
IKBKB Phosphorylation S672 0.670 0.244 _GPVSGS(ph)PDSMNASR_
ILK Ubiquitylation K85 -0.777 _DIVQK(gl)LLQYK_
ILK Ubiquitylation K426 -0.300 _LMK(gl)ICMNEDPAK_
ILK Ubiquitylation K435 -2.732 _ICMNEDPAK(gl)RPK_
INSR Ubiquitylation K1022 -0.603 _EK(gl)ITLLR_
INSR Ubiquitylation K1047 0.305 0.711 _DIIK(gl)GEAETR_
INSR Ubiquitylation K1057 0.482 0.484 _VAVK(gl)TVNESASLR_
INSR Ubiquitylation K1352 1.606 2.754 _DGGSSLGFK(gl)R_
JAK1 Ubiquitylation K227 -0.405 _YIPETLNK(gl)SIR_
JAK1 Ubiquitylation K249 0.116 0.771 _DFLK(gl)EFNNK_
JAK1 Ubiquitylation K559 -0.478 _EISNLLVATK(gl)K_
KDR Ubiquitylation K1064 -1.119 _DIYK(gl)DPDYVR_
KSR1 Phosphorylation S334 0.052 _FDLSHGS(ph)PQMVR_
KSR1 Phosphorylation S406 -0.052 -0.067 _RTES(ph)VPSDINNPVDR_
KSR1 Phosphorylation S569 -0.413 -0.383 _ADVLEAHEAEAEEPEAGKS(ph)EAEDDEDEVDDLPSSR_
LATS1 Phosphorylation T246 -2.282 _SVT(ph)PPPPPR_
LATS1 Phosphorylation T262 -1.011 _GTT(ph)PPPPSWEPNSQTK_
LATS1 Phosphorylation S278 0.261 0.599 _RYS(ph)GNM(ox)EYVISR_
LATS1 Phosphorylation S462 -0.408 _S(ph)NSFNNPLGNR_
LATS1 Phosphorylation S464 0.077 -0.151 _SNS(ph)FNNPLGNR_
LATS1 Phosphorylation S613 0.270 0.155 _KQITTS(ph)PITVR_
LATS1 Ubiquitylation K688 0.392 _MLCQK(gl)ESNYIR_
LCK Phosphorylation T37 -0.435 _YRPENTPEPVSTSVSHYGAEPT(ph)TVSPCPSSSAK_
LCK Ubiquitylation K191 -0.112 0.264 _ESETTK(gl)GAYSLSIR_
LCK Ubiquitylation K235 0.323 _AQFDTLQK(gl)LVK_
LCK Ubiquitylation K259 -1.613 _LTTVCPTVK(gl)PQTQGLAK_
LYN Ubiquitylation K20 -0.592 _GKDSLSDDGVDLK(gl)TQPVR_
LYN Ubiquitylation K40 0.100 _DPTSNK(gl)QQRPVPESQLLPGQR_
LYN Phosphorylation S104 0.944 0.841 _DSLS(ph)DDGVDLK_
LYN Ubiquitylation K213 0.441 _HYQK(gl)QADGLCR_
LYN Ubiquitylation K477 -0.191 _VENCPDELYDIMK(gl)MCWK_
MAP2K1 Ubiquitylation K192 -0.205 -0.241 _DVK(gl)PSNILVNSR_
MAP2K1 Phosphorylation S385 0.066 _RSDAEEVDFAGWLCSTIGLNQPS(ph)TPTHAAGV_
MAP2K1 Phosphorylation T386 0.377 _RSDAEEVDFAGWLCSTIGLNQPST(ph)PTHAAGV_
MAP2K2 Phosphorylation S23 0.873 0.258 _RKPVLPALTINPTIAEGPS(ph)PTSEGASEANLVDLQK_
MAP2K2 Phosphorylation T25 0.439 _RKPVLPALTINPTIAEGPSPT(ph)SEGASEANLVDLQK_
MAP2K2 Ubiquitylation K192 -0.205 -0.241 _DVK(gl)PSNILVNSR_
MAP2K2 Phosphorylation S293 -0.361 _ELEAIFGRPVVDGEEGEPHS(ph)ISPR_
MAP2K2 Phosphorylation S295 -0.234 0.026 _ELEAIFGRPVVDGEEGEPHSIS(ph)PR_
MAP2K2 Phosphorylation T394 0.570 0.158 _LNQPGT(ph)PTR_
MAP2K3 Ubiquitylation K84 0.045 -0.277 _GAYGVVEK(gl)VR_
MAP2K3 Ubiquitylation K232 -1.394 _TMDAGCK(gl)PYMAPER_
MAP2K3 Ubiquitylation K247 0.065 -0.737 _INPELNQK(gl)GYNVK_
MAP2K4 Phosphorylation S80 0.441 _LRTHS(ph)IESSGK_
MAP2K6 Phosphorylation T28 -1.813 -0.792 _EAFEQPQTSST(ph)PPRDLDSK_
MAP2K6 Ubiquitylation K232 0.220 _INPELNQK(gl)GYSVK_
MAP2K7 Ubiquitylation K9 -1.406 _(ac)AASSLEQK(gl)LSR_
MAP2K7 Ubiquitylation K300 -1.228 _GQIK(gl)LCDFGISGR_
MAP2K7 Ubiquitylation K442 -1.326 _DVMAK(gl)TESPR_
MAP3K1 Phosphorylation S292 0.209 _RAPS(ph)PDGFSPYSPEETNR_
MAP3K1 Phosphorylation S506 1.427 _SHDFYSHELS(ph)SPVDSPSSLR_
MAP3K1 Phosphorylation S507 1.436 _SHDFYSHELSS(ph)PVDSPSSLR_
MAP3K1 Phosphorylation S923 0.127 -0.120 _LSAS(ph)SEDISER_
MAP3K2 Phosphorylation S153 0.506 -0.231 _RLS(ph)IIGPTSR_
MAP3K2 Phosphorylation S163 -0.910 -0.776 _DRS(ph)SPPPGYIPDELHQVAR_
MAP3K2 Phosphorylation S164 -0.743 -0.966 _DRS(ph)SPPPGYIPDELHQVAR_
MAP3K2 Phosphorylation S239 -0.284 -0.618 _AQS(ph)YPDNHQEFSDYDNPIFEK_
MAP3K2 Phosphorylation S331 0.008 _RRGS(ph)DIDNPTLTVM(ox)DISPPSR_
MAP3K3 Phosphorylation S166 -0.325 _HLS(ph)VSSQNPGR_
MAP3K3 Phosphorylation S175 0.120 -0.091 _S(ph)SPPPGYVPER_
MAP3K3 Phosphorylation S176 0.120 -0.091 _S(ph)SPPPGYVPER_
MAP3K3 Phosphorylation S250 -0.070 _AQS(ph)FPDNR_
MAP3K4 Ubiquitylation K406 0.367 _DLNQK(gl)LR_
MAP3K4 Phosphorylation S1252 -0.654 _HSS(ph)PTEERDEPAYPR_
MAP3K5 Phosphorylation S1066 -1.241 _SISLPVPVLVEDTSSSSEYGSVS(ph)PDTELKVDPFSFK_
MAP3K5 Phosphorylation S1113 -1.408 -0.562 _TLFLGIPDENFEDHSAPPS(ph)PEEK_
MAP3K6 Phosphorylation S984 -0.616 -0.840 _VPEEPAAEEPAS(ph)PEESSGLSLLHQESK_
MAP3K7 Phosphorylation S374 0.149 -0.337 _GS(ph)SVESLPPTSEGK_
MAP3K7 Phosphorylation S375 0.171 -0.087 _GSS(ph)VESLPPTSEGK_
MAP3K7 Phosphorylation S389 1.072 1.445 _RMS(ph)ADMSEIEAR_
MAP3K7 Phosphorylation S439 0.246 0.198 _S(ph)IQDLTVTGTEPGQVSSR_
MAP3K7 Ubiquitylation K474 -0.385 -0.242 _MITTSGPTSEK(gl)PTR_
MAP3K7 Ubiquitylation K589 -0.104 _SLSTYYQQCK(gl)K_
MAP3K7 Ubiquitylation K590 -0.551 0.560 _K(gl)QLEVIR_
MAP4K4 Phosphorylation T704 0.480 0.190 _T(ph)TSRSPVLSR_
MAP4K4 Phosphorylation S706 0.353 0.381 _TTS(ph)RSPVLSR_
MAP4K4 Phosphorylation S708 0.247 0.386 _TTSRS(ph)PVLSR_
MAP4K4 Phosphorylation S716 0.989 -0.508 _RDS(ph)PLQGSGQQNSQAGQR_
MAP4K4 Phosphorylation S981 -0.167 -1.787 _KGS(ph)VVNVNPTNTRPQSDTPEIR_
MAP4K5 Ubiquitylation K36 1.547 _VGSGTYGDVYK(gl)AR_
MAPK1 Phosphorylation Y187 -0.935 -2.332 _VADPDHDHTGFLTEY(ph)VATR_
MAPK1 Ubiquitylation K203 -0.021 -0.779 _APEIMLNSK(gl)GYTK_
MAPK14 Phosphorylation S2 3.221 3.623 _(ac)S(ph)QERPTFYR_
MAPK14 Phosphorylation T180 0.958 1.087 _HTDDEM(ox)T(ph)GYVATR_
MAPK14 Phosphorylation Y182 1.388 1.374 _HTDDEM(ox)TGY(ph)VATR_
MAPK14 Ubiquitylation K249 0.073 -1.380 _LVGTPGAELLKK(gl)_
MAPK3 Phosphorylation Y187 -0.935 -2.332 _VADPDHDHTGFLTEY(ph)VATR_
MAPK3 Ubiquitylation K203 -0.021 -0.779 _APEIMLNSK(gl)GYTK_
MAPK3 Phosphorylation Y204 -0.807 -2.487 _IADPEHDHTGFLTEY(ph)VATR_
MAPK3 Ubiquitylation K289 -0.608 _NYLQSLPSKTK(gl)_
MAPK4 Phosphorylation Y187 -0.935 -2.332 _VADPDHDHTGFLTEY(ph)VATR_
MAPK4 Ubiquitylation K203 -0.021 -0.779 _APEIMLNSK(gl)GYTK_
MAPK6 Phosphorylation Y187 -0.935 -2.332 _VADPDHDHTGFLTEY(ph)VATR_
MAPK6 Phosphorylation S189 -0.821 -0.414 _GHLS(ph)EGLVTK_
MAPK6 Ubiquitylation K203 -0.021 -0.779 _APEIMLNSK(gl)GYTK_
MAPK6 Ubiquitylation K480 -1.705 _LIIDLSNWK(gl)EQSK_
MAPK6 Ubiquitylation K517 -1.941 -0.759 _AQIALEEASQQLAGK(gl)ER_
MAPK9 Phosphorylation Y185 3.533 _TACTNFMMTPY(ph)VVTR_
MAPKAPK5 Phosphorylation T182 -0.559 -0.706 _IDQGDLM(ox)T(ph)PQFTPYYVAPQVLEAQR_
MARK1 Phosphorylation S403 -1.363 -0.680 _SRPSSDLNNSTLQS(ph)PAHLK_
MARK2 Phosphorylation S387 3.794 _PSADLTNSS(ph)APSPSHK_
MARK2 Phosphorylation S390 5.149 4.932 _PSADLTNSSAPS(ph)PSHK_
MARK2 Phosphorylation S456 -1.253 -1.182 _VPAS(ph)PLPGLER_
MARK2 Phosphorylation S486 -0.028 0.163 _SRNS(ph)PLLER_
MARK2 Phosphorylation S569 -0.860 -0.742 _VPVAS(ph)PSAHNISSSGGAPDR_
MARK2 Phosphorylation S571 -0.724 _VPVASPS(ph)AHNISSSGGAPDR_
MARK3 Ubiquitylation K60 0.583 _LLK(gl)TIGK_
MARK3 Phosphorylation S152 -0.326 _SSEVRPSSDLNNSTGQS(ph)PHHK_
MARK3 Ubiquitylation K294 -0.769 -0.738 _FLVLNPIK(gl)R_
MARK3 Ubiquitylation K303 -1.652 _GTLEQIMK(gl)DR_
MARK3 Phosphorylation S400 -1.394 _VRPSSDLNNSTGQS(ph)PHHK_
MARK3 Phosphorylation Y418 -0.710 _RY(ph)SDHAGPAIPSVVAYPK_
MARK3 Phosphorylation S419 -0.429 -0.896 _RYS(ph)DHAGPAIPSVVAYPK_
MARK3 Phosphorylation S469 -1.030 -1.041 _GIAPAS(ph)PMLGNASNPNK_
MARK3 Phosphorylation S598 0.204 -0.252 _S(ph)RGSTNLFSK_
MARK3 Phosphorylation S601 3.150 1.434 _SRGS(ph)TNLFSK_
MARK3 Ubiquitylation K611 1.472 0.816 _LTSK(gl)LTR_
MARK4 Phosphorylation S438 1.483 0.784 _RS(ph)PTSTGEAELKEER_
MAST2 Phosphorylation S66 -0.592 _EQDVVTGVS(ph)PLLFR_
MAST2 Phosphorylation S74 0.187 0.488 _KLS(ph)NPDIFSSTGK_
MAST2 Phosphorylation S148 0.211 0.337 _NQSLGQS(ph)APSLTAGLK_
MAST2 Phosphorylation S876 0.406 0.431 _SLS(ph)EEKEDHSDGLAGLK_
MAST2 Phosphorylation S900 -0.032 _SWVIGS(ph)PEILR_
MAST2 Phosphorylation S931 -0.002 0.339 _RCS(ph)GLLDAPR_
MAST2 Phosphorylation S1256 0.099 -0.774 _SLS(ph)SGESGPGSPTHSHSLSPR_
MAST2 Phosphorylation S1381 -0.056 -0.059 _LHLS(ph)PPLGR_
MAST3 Phosphorylation S711 0.306 _VYSSS(ph)EFLAVQPTPTFAER_
MAST3 Phosphorylation S1223 0.701 0.567 _GQS(ph)ADKLGTGER_
MAST4 Ubiquitylation K841 0.874 _LGTGGAYEVK(gl)QHR_
MAST4 Phosphorylation S1373 -0.457 -0.761 _S(ph)AGNIPLSPLAR_
MAST4 Phosphorylation S1782 -0.377 _VDSGTEKPGLVAPES(ph)PVRK_
MAST4 Phosphorylation S1825 0.448 0.233 _TELPS(ph)PESAQSPSPSGDVR_
MASTL Ubiquitylation K266 -0.911 _DTTPYSSK(gl)LLK_
MASTL Ubiquitylation K350 -0.870 _LCAK(gl)SANAIETK_
MASTL Phosphorylation S370 0.034 0.079 _KDLELALS(ph)PIHNSSALPTTGR_
MASTL Phosphorylation S453 -0.863 -0.537 _NFELVDSS(ph)PCKK_
MASTL Ubiquitylation K456 -0.960 _NFELVDSSPCK(gl)K_
MASTL Ubiquitylation K457 -0.960 _NFELVDSSPCK(gl)K_
MASTL Phosphorylation T611 0.195 _ESSFEESNIEDPLIVT(ph)PDCQEKTSPK_
MASTL Phosphorylation T618 -0.221 _ESSFEESNIEDPLIVTPDCQEKT(ph)SPK_
MASTL Phosphorylation S619 -0.221 _ESSFEESNIEDPLIVTPDCQEKT(ph)SPK_
MELK Ubiquitylation K55 -0.604 _IK(gl)TEIEALK_
MELK Ubiquitylation K419 -1.760 _TPANK(gl)LK_
MELK Ubiquitylation K597 -0.858 _GYTLK(gl)CQTQSDFGK_
MELK Ubiquitylation K650 -0.307 _LVEDILSSCK(gl)V_
MERTK Ubiquitylation K856 0.219 _LQLEK(gl)LLESLPDVR_
MET Ubiquitylation K962 0.146 _QIK(gl)DLGSELVR_
MET Phosphorylation S988 0.064 _S(ph)VSPTTEM(ox)VSNESVDYR_
MET Phosphorylation S990 0.192 -0.105 _SVS(ph)PTTEM(ox)VSNESVDYR_
MET Phosphorylation T992 0.501 -0.048 _SVSPT(ph)TEMVSNESVDYR_
MET Phosphorylation S997 0.285 _S(ph)VSPTTEMVS(ph)NESVDYR_
MINK1 Phosphorylation S763 0.045 -0.277 _SDSVLPASHGHLPQAGS(ph)LER_
MYO3A Ubiquitylation K399 2.702 _LYIGSK(gl)R_
NEK1 Phosphorylation S664 0.535 _SSDVSPPLGQHETGGS(ph)PSK_
NEK1 Phosphorylation S1052 0.195 0.324 _TCS(ph)LPDLSK_
NEK1 Phosphorylation S1126 0.472 0.693 _EQPGEEYS(ph)EEEESVLK_
NEK2 Ubiquitylation K152 -2.296 _DLKPANVFLDGK(gl)QNVK_
NEK2 Ubiquitylation K353 -1.746 _AENLLK(gl)NYSLLK_
NEK2 Ubiquitylation K359 -0.192 _NYSLLK(gl)ER_
NEK2 Ubiquitylation K409 -0.182 _SENSESQLTSKSK(gl)_
NEK3 Ubiquitylation K404 -0.020 _GGSVIKYSK(gl)_
NEK4 Phosphorylation S457 -0.084 0.444 _DQS(ph)LALSPK_
NEK4 Phosphorylation S461 -0.106 0.187 _DQSLALS(ph)PK_
NEK4 Phosphorylation S563 -0.692 -0.730 _DLFAFQES(ph)PPR_
NEK4 Phosphorylation S661 0.914 0.107 _RLS(ph)SDCSVTQER_
NEK6 Ubiquitylation K277 -1.179 -0.174 _IEQCDYPPLPGEHYSEK(gl)LR_
NEK9 Ubiquitylation K200 -0.124 _LGDYGLAKK(gl)_
NEK9 Ubiquitylation K327 -1.575 _VTLLNAPTK(gl)RPR_
NEK9 Phosphorylation S331 0.416 0.370 _S(ph)STVTEAPIAVVTSR_
NEK9 Phosphorylation S332 -0.579 _SS(ph)TVTEAPIAVVTSR_
NEK9 Phosphorylation T333 0.736 0.618 _SST(ph)VTEAPIAVVTSR_
NEK9 Ubiquitylation K361 -1.833 _STPQK(gl)LDVIK_
NEK9 Ubiquitylation K366 0.951 0.744 _LDVIK(gl)SGCSAR_
NEK9 Ubiquitylation K606 -0.077 -0.476 _TIAPGK(gl)THTAAIDER_
NEK9 Phosphorylation S868 -0.169 -0.040 _VASEAPLEHKPQVEAS(ph)SPR_
NEK9 Phosphorylation S869 -0.369 0.355 _VASEAPLEHKPQVEAS(ph)SPR_
NRBP1 Phosphorylation S2 0.201 0.232 _S(ph)EGESQTVLSSGSDPK_
NRBP1 Phosphorylation S11 0.309 -0.085 _(ac)SEGESQTVLS(ph)SGSDPK_
NRBP1 Phosphorylation T441 -0.603 -0.439 _TPT(ph)PEPAEVETR_
OBSCN Phosphorylation S1485 1.190 _LSFS(ph)SKVR_
OBSCN Phosphorylation S1486 0.964 1.070 _LSFSS(ph)KVR_
OXSR1 Ubiquitylation K303 -0.098 _NKEFLQEK(gl)TLQR_
OXSR1 Phosphorylation S425 3.178 _TAQALSSGS(ph)GSQETK_
OXSR1 Phosphorylation S427 2.571 _TAQALSSGSGS(ph)QETK_
PAK1 Phosphorylation S174 -1.439 -0.597 _AVSETPAVPPVS(ph)EDEDDDDDDATPPPVIAPRPEHTK_
PAK1 Phosphorylation T212 0.312 _SVIEPLPVT(ph)PTR_
PAK1 Phosphorylation T219 -0.560 -0.962 _DVAT(ph)SPISPTENNTT(ph)PPDALTR_
PAK1 Phosphorylation S220 -0.916 -0.774 _DVATS(ph)PISPTENNTTPPDALTR_
PAK1 Phosphorylation S223 1.033 0.153 _DVATSPIS(ph)PTENNTTPPDALTR_
PAK1 Phosphorylation T225 -1.278 _DVATSPISPT(ph)ENNTTPPDALTR_
PAK1 Phosphorylation T230 -1.418 -1.502 _DVATSPISPTENNTT(ph)PPDALTR_
PAK2 Phosphorylation S2 -1.228 -0.902 _(ac)S(ph)DNGELEDKPPAPPVR_
PAK2 Ubiquitylation K136 1.213 _FYDSNTVK(gl)QK_
PAK2 Phosphorylation S141 -0.294 -0.321 _YLS(ph)FTPPEK_
PAK2 Ubiquitylation K370 -0.565 _DIK(gl)SDNVLLGMEGSVK_
PAK4 Phosphorylation S104 -0.563 -0.422 _RDS(ph)PPPPAR_
PAK4 Phosphorylation S181 -0.528 -0.724 _DKRPLS(ph)GPDVGTPQPAGLASGAK_
PAK4 Phosphorylation T207 -0.287 -0.118 _LAAGRPFNT(ph)YPR_
PAK4 Phosphorylation S291 -3.268 _GAPSPGVLGPHASEPQLAPPACTPAAPAVPGPPGPRS(ph)PQREPQR_
PAK4 Phosphorylation S474 -0.003 0.050 _S(ph)LVGTPYWMAPELISR_
PAK4 Phosphorylation T478 0.024 _RKSLVGT(ph)PYWM(ox)APELISR_
PASK Phosphorylation S115 0.506 _GLS(ph)SGWSSPLLPAPVCNPNK_
PASK Phosphorylation S524 0.135 -0.412 _EEPVAIES(ph)PGQDLLGESR_
PBK Phosphorylation T9 0.017 -1.222 _(ac)M(ox)EGISNFKT(ph)PSK_
PBK Phosphorylation S19 -1.585 _KS(ph)VLCSTPTINIPASPFMQK_
PBK Phosphorylation T24 -1.294 _SVLCST(ph)PTINIPAS(ph)PFM(ox)QK_
PBK Phosphorylation S32 -1.305 _SVLCST(ph)PTINIPAS(ph)PFM(ox)QK_
PBK Ubiquitylation K64 0.018 _GLSHSPWAVK(gl)K_
PBK Ubiquitylation K65 -0.453 _K(gl)INPICNDHYR_
PBK Ubiquitylation K87 -0.001 -0.109 _LMDEAK(gl)ILK_
PBK Ubiquitylation K155 0.384 _GLK(gl)YLHQEK_
PBK Ubiquitylation K169 0.117 -0.027 _LLHGDIK(gl)SSNVVIK_
PDPK1 Phosphorylation S241 0.358 0.361 _ANS(ph)FVGTAQYVSPELLTEK_
PDPK1 Ubiquitylation K257 0.571 -0.234 _ANSFVGTAQYVSPELLTEK(gl)SACK_
PEAK1 Phosphorylation S281 0.153 _ANTLS(ph)PVR_
PEAK1 Phosphorylation S568 0.247 _S(ph)APTS(ph)PTATNISSK_
PEAK1 Phosphorylation S572 0.247 _S(ph)APTS(ph)PTATNISSK_
PEAK1 Phosphorylation S823 -0.236 _SLFTS(ph)QPSGEAEAPQTTDSPTTK_
PEAK1 Phosphorylation S826 -0.505 -0.656 _SLFTSQPS(ph)GEAEAPQTTDSPTTK_
PEAK1 Phosphorylation S1036 5.225 _SHSS(ph)PSQIPK_
PHKG2 Ubiquitylation K265 0.212 _SSTVK(gl)DLISR_
PIM3 Ubiquitylation K30 -0.621 _ILQPAK(gl)ADKESFEK_
PIM3 Ubiquitylation K69 0.591 _IADGLPVAVK(gl)HVVK_
PIM3 Ubiquitylation K172 -0.139 _DIK(gl)DENLLVDLR_
PKMYT1 Ubiquitylation K58 -1.709 _SLPPPPPAK(gl)GSIPISR_
PKN1 Phosphorylation S561 -0.165 0.098 _LNLGTDSDS(ph)SPQK_
PKN1 Phosphorylation S562 0.231 1.001 _LNLGTDSDSS(ph)PQK_
PKN1 Phosphorylation T914 -0.855 _TDVSNFDEEFTGEAPT(ph)LSPPRDAR_
PKN1 Phosphorylation S916 -0.482 -0.510 _TDVSNFDEEFTGEAPTLS(ph)PPR_
PKN2 Phosphorylation S110 -0.178 0.111 _LQELNAHIVVS(ph)DPEDITDCPR_
PKN2 Phosphorylation S360 -0.306 -0.065 _ATSVALPGWS(ph)PSETR_
PKN2 Ubiquitylation K385 0.967 _NLLK(gl)TDDLSNDVCAVLK_
PKN2 Ubiquitylation K447 0.735 _SLCAVK(gl)FLR_
PKN2 Ubiquitylation K502 1.448 _QQGK(gl)TFLR_
PKN2 Phosphorylation T527 -1.598 -1.740 _AIPT(ph)VNHSGTFSPQAPVPTTVPVVDVR_
PKN2 Phosphorylation S535 -1.794 _AIPTVNHSGTFS(ph)PQAPVPTTVPVVDVR_
PKN2 Phosphorylation S582 0.725 0.956 _AS(ph)SLGEIDESSELR_
PKN2 Phosphorylation S583 0.827 1.023 _ASS(ph)LGEIDESSELR_
PKN2 Ubiquitylation K930 -0.445 _VK(gl)PPFIPTIR_
PKN2 Phosphorylation T958 -1.135 -0.827 _GREDVSNFDDEFTSEAPILT(ph)PPREPR_
PKN3 Ubiquitylation K202 -1.718 _NVVK(gl)LLSSR_
PKN3 Phosphorylation S544 -1.006 -1.351 _RGPS(ph)PPASPTR_
PLK1 Ubiquitylation K358 -2.258 _EK(gl)EEPVVR_
PLK1 Ubiquitylation K574 1.656 _LSLLEEYGCCK(gl)ELASR_
PLK2 Ubiquitylation K438 -0.272 _SGTPAVENK(gl)QQIGDAIR_
POMK Ubiquitylation K3 -1.357 -0.509 _(ac)MEK(gl)QPQNSR_
POMK Ubiquitylation K93 0.734 _VGEGAVK(gl)R_
PRKAA1 Ubiquitylation K271 -0.536 _ATIK(gl)DIR_
PRKAA1 Ubiquitylation K396 -0.419 _HTLDELNPQK(gl)SK_
PRKAA1 Ubiquitylation K485 -1.326 -1.554 _SIDDEITEAK(gl)SGTATPQR_
PRKAA2 Ubiquitylation K271 -0.536 _ATIK(gl)DIR_
PRKAA2 Phosphorylation S377 -0.020 _MPPLIADS(ph)PK_
PRKACA Ubiquitylation K30 -0.143 _AKEDFLKK(gl)_
PRKACA Ubiquitylation K93 0.839 0.714 _QIEHTLNEK(gl)R_
PRKACB Ubiquitylation K30 -0.143 _AKEDFLKK(gl)_
PRKACB Ubiquitylation K93 0.839 0.714 _QIEHTLNEK(gl)R_
PRKACB Phosphorylation T243 -0.835 _T(ph)WTLCGTPEYLAPEIILSK_
PRKACB Phosphorylation T245 -0.116 -0.102 _TWT(ph)LCGTPEYLAPEIILSK_
PRKCA Phosphorylation S10 -0.650 0.036 _(ac)ADVFPGNDS(ph)TASQDVANR_
PRKCA Phosphorylation S13 -1.038 0.335 _(ac)ADVFPGNDSTAS(ph)QDVANR_
PRKCA Phosphorylation S226 0.693 0.415 _STLNPQWNES(ph)FTFK_
PRKCA Ubiquitylation K316 -0.522 -0.535 _LGPAGNK(gl)VISPSEDR_
PRKCB Phosphorylation S10 -0.650 0.036 _(ac)ADVFPGNDS(ph)TASQDVANR_
PRKCB Phosphorylation S13 -1.038 0.335 _(ac)ADVFPGNDSTAS(ph)QDVANR_
PRKCB Phosphorylation S226 0.693 0.415 _STLNPQWNES(ph)FTFK_
PRKCB Ubiquitylation K315 0.213 0.518 _ISQGTK(gl)VPEEK_
PRKCD Ubiquitylation K138 -0.141 _SEDEAK(gl)FPTMNR_
PRKCD Ubiquitylation K222 0.185 0.658 _DTIFQK(gl)ER_
PRKCD Phosphorylation S302 -0.240 -0.222 _S(ph)DSASSEPVGIYQGFEK_
PRKCD Phosphorylation S304 0.378 0.289 _RSDS(ph)ASSEPVGIYQGFEK_
PRKCD Phosphorylation S506 -0.213 0.200 _AS(ph)TFCGTPDYIAPEILQGLK_
PRKCD Phosphorylation T507 -0.149 0.240 _AS(ph)TFCGTPDYIAPEILQGLK_
PRKCD Ubiquitylation K641 -2.000 _DYSNFDQEFLNEK(gl)AR_
PRKCD Phosphorylation S645 0.577 0.832 _ARLS(ph)YSDK_
PRKCD Phosphorylation S647 0.886 0.853 _ARLSYS(ph)DK_
PRKCH Ubiquitylation K36 -0.644 _K(gl)GHQLLDPYLTVSVDQVR_
PRKCH Ubiquitylation K152 1.064 _IFK(gl)HFTR_
PRKCH Phosphorylation S317 -0.562 -0.534 _TLAGMGLQPGNIS(ph)PTSK_
PRKCH Phosphorylation T656 -0.471 _SREDVSNFDPDFIKEEPVLT(ph)PIDEGHLPM(ox)INQDEFR_
PRKCI Ubiquitylation K244 0.289 _ESGK(gl)ASSSLGLQDFDLLR_
PRKCI Ubiquitylation K488 -0.090 0.847 _SLSVK(gl)AASVLK_
PRKCQ Phosphorylation S685 0.911 _ALINS(ph)MDQNMFR_
PRKCZ Phosphorylation T560 -0.884 -1.578 _KQALPPFQPQITDDYGLDNFDTQFTSEPVQLT(ph)PDDEDAIKR_
PRKD1 Phosphorylation S207 0.941 1.048 _RLS(ph)NVSLTGVSTIR_
PRKD1 Phosphorylation T219 -0.068 -0.162 _T(ph)SSAELSTSAPDEPLLQK_
PRKD1 Phosphorylation S221 -0.662 -0.500 _TSS(ph)AELSTSAPDEPLLQK_
PRKD1 Phosphorylation S225 -0.970 -0.919 _TSSAELSTS(ph)APDEPLLSPVSPGFEQK_
PRKD1 Phosphorylation S236 -0.132 _TSSAELSTSAPDEPLLSPVS(ph)PGFEQK_
PRKD1 Phosphorylation S251 0.474 0.751 _SNS(ph)QSYIGRPIHLDK_
PRKD1 Phosphorylation S399 0.023 0.162 _TIS(ph)PSTSNNIPLMR_
PRKD1 Ubiquitylation K730 1.177 _IIGEK(gl)SFR_
PRKD1 Phosphorylation S744 -0.226 -0.287 _S(ph)VVGTPAYLAPEVLR_
PRKD2 Phosphorylation S197 0.239 0.895 _RLS(ph)STSLASGHSVR_
PRKD2 Phosphorylation T211 -0.119 _LGT(ph)SESLPCTAEELSR_
PRKD2 Phosphorylation S212 0.113 _LGTS(ph)ESLPCTAEELSR_
PRKD2 Phosphorylation S214 0.216 0.302 _LGTSES(ph)LPCTAEELSR_
PRKD2 Phosphorylation S710 -0.413 -0.511 _S(ph)VVGTPAYLAPEVLLNQGYNR_
PRKD2 Phosphorylation T714 -0.279 _S(ph)VVGTPAYLAPEVLLNQGYNR_
PRKD2 Ubiquitylation K730 1.177 _IIGEK(gl)SFR_
PRKD2 Phosphorylation S886 -0.718 -0.305 _DLGGACPPQDHDMQGLAERIS(ph)VL_
PRKD3 Phosphorylation S30 -1.576 _SVLPTAIPAVLPAAS(ph)PCS(ph)SPK_
PRKD3 Phosphorylation S31 -1.576 _SVLPTAIPAVLPAASPCS(ph)SPK_
PRKD3 Phosphorylation S364 -0.830 -0.918 _GLDDTEEPS(ph)PPEDK_
PRKD3 Phosphorylation S399 0.023 0.162 _TIS(ph)PSTSNNIPLMR_
PRKD3 Ubiquitylation K730 1.177 _IIGEK(gl)SFR_
PRKD3 Phosphorylation S744 -0.226 -0.287 _S(ph)VVGTPAYLAPEVLR_
PRPF4B Phosphorylation S243 0.893 0.869 _ARS(ph)PTDDKVK_
PRPF4B Phosphorylation T245 0.305 0.249 _ARS(ph)PTDDKVK_
PRPF4B Phosphorylation S263 0.681 0.659 _KS(ph)PIINESR_
PRPF4B Phosphorylation S280 1.312 1.402 _SRS(ph)PVDLR_
PRPF4B Phosphorylation S417 0.565 _DAS(ph)PINRWS(ph)PTR_
PRPF4B Phosphorylation S423 0.565 _DAS(ph)PINRWS(ph)PTR_
PRPF4B Ubiquitylation K656 -0.314 _AAGIGK(gl)DFKENPNLR_
PRPF4B Phosphorylation Y835 0.441 0.449 _LCDFGSASHVADNDITPY(ph)LVSR_
PRPF4B Phosphorylation S838 -0.194 0.423 _LCDFGSASHVADNDITPYLVS(ph)R_
PTK6 Phosphorylation S47 0.375 0.573 _RDS(ph)LEEGELR_
PTK6 Phosphorylation T61 0.721 _MEIT(ph)IRNSPYR_
PTK6 Phosphorylation S65 0.730 0.552 _MEITIRNS(ph)PYR_
PTK6 Phosphorylation S234 -0.737 -0.712 _S(ph)PPRPPR_
PTK6 Phosphorylation S283 0.324 0.483 _DLLSDLQDIS(ph)DSER_
PTK6 Ubiquitylation K467 -0.286 _TDEIVALK(gl)R_
PTK6 Phosphorylation S589 0.529 0.585 _EYGS(ph)PLKAYT(ph)PVVVTLWYR_
PTK6 Phosphorylation T595 0.472 0.397 _AYT(ph)PVVVTLWYR_
PTK6 Ubiquitylation K672 -1.465 _IWPGYSELPAVK(gl)K_
PTK6 Ubiquitylation K673 -1.465 _IWPGYSELPAVK(gl)K_
PTK6 Ubiquitylation K719 -0.672 _ISAEDGLK(gl)HEYFR_
PTK6 Phosphorylation T751 -0.349 -0.460 _RGT(ph)SPRPPEGGLGYSQLGDDDLK_
PTK6 Phosphorylation S752 -0.526 -0.643 _RGTS(ph)PRPPEGGLGYSQLGDDDLK_
PTK7 Ubiquitylation K843 0.757 0.315 _SLQSK(gl)DEQQQLDFRR_
PTK7 Ubiquitylation K906 0.519 -0.411 _LK(gl)SQPLSTK_
RAF1 Phosphorylation S29 0.028 -0.571 _DAVFDGSSCIS(ph)PTIVQQFGYQR_
RAF1 Phosphorylation T31 0.028 -0.669 _DAVFDGSSCIS(ph)PTIVQQFGYQR_
RAF1 Phosphorylation S244 0.053 _YSTPHAFTFNTSS(ph)PSSEGSLSQR_
RAF1 Phosphorylation S259 -0.069 0.054 _STS(ph)TPNVHM(ox)VSTTLPVDSR_
RAF1 Phosphorylation S301 -0.651 _SHSESASPSALSSSPNNLS(ph)PTGWSQPK_
RAF1 Phosphorylation T303 -0.664 _SHSESASPSALSSSPNNLSPT(ph)GWSQPK_
RAF1 Phosphorylation S497 -0.449 _SRWS(ph)GSQQVEQPTGSVLWMAPEVIR_
RAF1 Phosphorylation S621 0.212 0.271 _SAS(ph)EPSLHR_
RAF1 Phosphorylation S642 -0.197 0.463 _AAHTEDINACTLTTS(ph)PR_
RIOK1 Phosphorylation S21 -0.198 -0.209 _VVPGQFDDADS(ph)SDSENR_
RIOK1 Phosphorylation S22 -0.379 -0.219 _VVPGQFDDADSS(ph)DSENR_
RIOK1 Ubiquitylation K299 -0.532 0.119 _NVQLSESK(gl)AR_
RIOK1 Ubiquitylation K426 -0.364 0.051 _SSQDHVDEEVFK(gl)R_
RIPK1 Ubiquitylation K642 -0.431 _EGIK(gl)GATVGK_
RIPK2 Ubiquitylation K410 -2.810 _AAFCDHK(gl)TTPCSSAIINPLSTAGNSER_
RIPK2 Phosphorylation S531 0.884 0.839 _SPS(ph)LNLLQNK_
RIPK2 Ubiquitylation K538 -2.659 _SPSLNLLQNK(gl)SM_
RNASEL Phosphorylation S21 0.047 -0.107 _YIASVQGSTPS(ph)PR_
RNASEL Ubiquitylation K94 -0.527 _SVELNPTQK(gl)DLVLK_
RNASEL Ubiquitylation K106 0.667 _IAELLCK(gl)NDVTDGR_
RNASEL Ubiquitylation K776 -0.046 -0.521 _NADSEIK(gl)HSTPSPTR_
RNASEL Phosphorylation S788 0.362 -0.041 _YSLS(ph)PSK_
RNASEL Phosphorylation S796 0.553 0.575 _SYKYS(ph)PK_
RNASEL Phosphorylation S955 -0.786 0.030 _FESPATGILS(ph)PR_
RNASEL Phosphorylation S1160 -1.328 _NHETDGGS(ph)AHGDDDDDGPHFEPVVPLPDKIEVK_
RNASEL Ubiquitylation K1220 0.641 _GIGNVK(gl)ILR_
RNASEL Phosphorylation T1396 -0.510 -0.398 _ELVGPPLAETVFT(ph)PKT(ph)SPENVQDR_
RNASEL Phosphorylation T1399 -0.665 _ELVGPPLAETVFT(ph)PKT(ph)SPENVQDR_
RNASEL Phosphorylation S1400 -0.440 0.082 _ELVGPPLAETVFT(ph)PKTS(ph)PENVQDR_
RNASEL Phosphorylation S1456 0.018 0.508 _SGSSFVHQAS(ph)FK_
RNASEL Phosphorylation S1573 0.499 _CVACQNPDKPS(ph)PSTSVPAPASFK_
RNASEL Ubiquitylation K1963 -0.768 _STSGEGFQFGK(gl)K_
RNASEL Ubiquitylation K1964 -0.768 _STSGEGFQFGK(gl)K_
RNASEL Ubiquitylation K2061 0.441 0.872 _GLGNLK(gl)ILK_
RNASEL Phosphorylation S2250 1.539 -0.701 _EDALDDSVSSSSVHASPLAS(ph)SPVRK_
RNASEL Phosphorylation S2251 -0.023 _EDALDDSVSSSSVHASPLASS(ph)PVRK_
RNASEL Phosphorylation S2276 0.074 0.029 _SALS(ph)PSKSPAK_
RNASEL Phosphorylation S2280 0.065 0.135 _SALSPSKS(ph)PAK_
RNASEL Phosphorylation T2293 0.717 0.584 _LNQSGTSVGT(ph)DEESDVTQEEER_
RNASEL Ubiquitylation K2358 0.436 0.327 _GIGDIK(gl)ILQNYDNK_
RNASEL Ubiquitylation K2379 -0.664 0.332 _DQVLK(gl)LCANHR_
RNASEL Ubiquitylation K2396 -0.954 0.190 _ITPDMTLQNMK(gl)GTER_
RNASEL Phosphorylation S2454 0.335 0.393 _DSLIT(ph)PHVS(ph)R_
RNASEL Phosphorylation S2510 -0.171 0.107 _AVVS(ph)PPKFVFGSESVK_
RNASEL Ubiquitylation K2592 -0.298 _NSDIEQSSDSK(gl)VK_
RNASEL Ubiquitylation K2594 -0.298 _NSDIEQSSDSK(gl)VK_
RNASEL Phosphorylation T2613 -0.775 -0.709 _NLFASFPTEESSINYTFKT(ph)PEK_
RNASEL Ubiquitylation K2650 0.439 _ALATK(gl)LK_
RNASEL Phosphorylation Y2666 0.598 _NRPDY(ph)VSEEEEDDEDFETAVKK_
RNASEL Phosphorylation S2668 0.584 0.573 _NRPDYVS(ph)EEEEDDEDFETAVK_
RNASEL Phosphorylation S2804 0.874 _SIS(ph)SPSVSSETM(ox)DKPVDLSTR_
RNASEL Phosphorylation S2805 -0.018 0.448 _SISS(ph)PSVSSETMDKPVDLSTR_
RNASEL Phosphorylation S2900 -0.395 -0.513 _VGEDEDGS(ph)DEEVVHNEDIHFEPIVSLPEVEVK_
RNASEL Ubiquitylation K2935 -1.498 0.007 _SGEEDEEILFK(gl)ER_
RNASEL Phosphorylation S3207 0.368 0.527 _IESFGS(ph)PK_
ROCK1 Phosphorylation S1105 -0.245 -0.845 _LLDLSDSTSVAS(ph)FPSADETDGNLPESR_
ROCK2 Ubiquitylation K1222 -0.679 _ADAK(gl)EIPR_
ROR2 Ubiquitylation K97 0.598 _WLK(gl)NDAPVVQEPR_
ROR2 Ubiquitylation K510 -0.960 _TLK(gl)DKAEGPLREEFR_
ROR2 Ubiquitylation K512 0.282 _DK(gl)AEGPLREEFR_
RPS6KA1 Phosphorylation S227 0.363 0.496 _AYS(ph)FCGTVEYM(ox)APEVVNR_
RPS6KA1 Phosphorylation T231 0.315 _KAYSFCGT(ph)VEYMAPEVVNR_
RPS6KA1 Ubiquitylation K316 -1.156 _LGSGPDGAEEIK(gl)R_
RPS6KA1 Phosphorylation T359 -0.149 -0.339 _T(ph)PKDSPGIPPSAGAHQLFR_
RPS6KA1 Phosphorylation S363 -0.711 -0.697 _TPKDS(ph)PGIPPSAGAHQLFR_
RPS6KA1 Ubiquitylation K566 -0.152 _ICDFGFAK(gl)QLR_
RPS6KA3 Phosphorylation S227 0.363 0.496 _AYS(ph)FCGTVEYM(ox)APEVVNR_
RPS6KA3 Phosphorylation T231 0.315 _KAYSFCGT(ph)VEYMAPEVVNR_
RPS6KA3 Ubiquitylation K322 -0.076 -0.376 _LGAGPDGVEEIK(gl)R_
RPS6KA3 Phosphorylation T365 -0.892 -1.003 _T(ph)PKDSPGIPPSANAHQLFR_
RPS6KA3 Phosphorylation S369 -0.621 -0.862 _TPKDS(ph)PGIPPSANAHQLFR_
RPS6KA3 Ubiquitylation K566 -0.152 _ICDFGFAK(gl)QLR_
RPS6KA3 Phosphorylation S715 -0.923 -0.880 _NQS(ph)PVLEPVGR_
RPS6KA6 Phosphorylation S227 0.363 0.496 _AYS(ph)FCGTVEYM(ox)APEVVNR_
RPS6KA6 Phosphorylation T231 0.315 _KAYSFCGT(ph)VEYMAPEVVNR_
RPS6KA6 Ubiquitylation K566 -0.152 _ICDFGFAK(gl)QLR_
RPS6KB1 Ubiquitylation K99 -0.316 _VLGK(gl)GGYGK_
RPS6KB1 Phosphorylation S447 -0.525 -0.458 _TPVS(ph)PVKFSPGDFWGR_
RPS6KB2 Ubiquitylation K99 -0.316 _VLGK(gl)GGYGK_
RPS6KL1 Ubiquitylation K46 3.372 _VALGVPDMTK(gl)R_
RYK Ubiquitylation K302 0.463 _IEK(gl)NDLR_
SCYL1 Phosphorylation S754 -0.053 _PSTQPRPDS(ph)WGEDNWEGLETDSR_
SCYL2 Phosphorylation S677 0.455 0.911 _RAS(ph)LTLEEK_
SCYL3 Phosphorylation Y364 0.926 _(ac)MVLLSHIEAY(ph)VEHFT(ph)QEQLK_
SCYL3 Phosphorylation T369 0.926 _(ac)MVLLSHIEAY(ph)VEHFT(ph)QEQLK_
SCYL3 Phosphorylation S707 2.283 2.580 _KDDVS(ph)PVMQFSSK_
SIK1 Phosphorylation S435 -0.305 _PVS(ph)PSSLLDTAISEEAR_
SLK Ubiquitylation K179 -0.345 _LADFGVSAK(gl)NTR_
SLK Phosphorylation S189 0.169 0.226 _RDS(ph)FIGTPYWM(ox)APEVVM(ox)CETSK_
SLK Phosphorylation T193 0.121 0.097 _RDSFIGT(ph)PYWMAPEVVM(ox)CETSK_
SLK Phosphorylation Y195 0.182 0.287 _RDSFIGTPY(ph)WMAPEVVMCETSK_
SLK Ubiquitylation K246 0.555 _VLLK(gl)IAK_
SLK Phosphorylation T569 0.771 0.828 _VDEDSAEDT(ph)QSNDGKEVVEVGQK_
SLK Phosphorylation S571 0.209 -0.101 _VDEDSAEDTQS(ph)NDGKEVVEVGQK_
SLK Ubiquitylation K1114 -0.291 _QFAAQEEK(gl)R_
SNRK Phosphorylation S390 0.034 0.536 _IDVPQDLEDDLTATPLSHATVPQS(ph)PAR_
SRC Phosphorylation S17 -0.604 -0.689 _S(ph)LEPAENVHGAGGGAFPASQTPSKPASADGHR_
SRC Phosphorylation S75 0.060 0.331 _LFGGFNSSDTVTS(ph)PQR_
SRPK1 Phosphorylation S67 -1.128 -1.153 _GSAPHSESDLPEQEEEILGS(ph)DDDEQEDPNDYCK_
SRPK1 Ubiquitylation K579 0.354 _K(gl)LIVAGK_
SRPK1 Ubiquitylation K585 0.939 _KLIVAGK(gl)YSK_
SRPK2 Phosphorylation S483 -1.638 _IPESQFPEFSTSLFSGSLEPVACGSVLSEGSPLTEQEES(ph)SPSHDR_
SRPK2 Phosphorylation S496 0.096 _TVSAS(ph)STGDLPK_
SRPK2 Phosphorylation S497 -0.015 -0.154 _TVSASS(ph)TGDLPK_
SRPK2 Ubiquitylation K618 0.453 _HFALSGK(gl)YSR_
STK10 Phosphorylation S191 -0.050 _RDS(ph)FIGTPYWMAPEVVMCETMK_
STK10 Phosphorylation T195 -0.024 _RDSFIGT(ph)PYWMAPEVVMCETMK_
STK10 Phosphorylation S438 1.247 0.224 _QVAEQGGDLS(ph)PAANR_
STK10 Ubiquitylation K849 0.058 _IKQFSQQEEK(gl)R_
STK10 Phosphorylation T952 -0.848 -0.879 _LSEEAECPNPST(ph)PSK_
STK11 Phosphorylation S31 0.437 0.073 _IDS(ph)TEVIYQPR_
STK11 Phosphorylation T32 1.256 0.248 _IDS(ph)TEVIYQPR_
STK17A Ubiquitylation K43 -0.699 _GK(gl)FAVVR_
STK17B Ubiquitylation K43 -0.699 _GK(gl)FAVVR_
STK17B Ubiquitylation K53 -1.448 _QCISK(gl)STGQEYAAK_
STK24 Phosphorylation S4 0.269 0.161 _(ac)AHS(ph)PVAVQVPGMQNNIADPEELFTK_
STK24 Phosphorylation S4 0.816 0.517 _(ac)AHS(ph)PVQSGLPGMQNLK_
STK24 Ubiquitylation K162 -0.327 0.155 _GLDYLHSEKK(gl)_
STK24 Ubiquitylation K197 -0.399 0.038 _LADFGVAGQLTDTQIK(gl)R_
STK24 Ubiquitylation K255 -0.986 _VLFLIPK(gl)NNPPTLVGDFTK_
STK24 Ubiquitylation K298 0.008 -0.419 _FIVK(gl)NSK_
STK24 Ubiquitylation K302 -0.101 0.068 _K(gl)TSYLTELIDR_
STK24 Ubiquitylation K420 -0.470 _SIAVAEAACPGITDK(gl)MVK_
STK24 Ubiquitylation K423 -0.470 -0.024 _SIAVAEAACPGITDKMVK(gl)_
STK25 Phosphorylation S4 0.269 0.161 _(ac)AHS(ph)PVAVQVPGMQNNIADPEELFTK_
STK25 Ubiquitylation K162 -0.327 0.155 _GLDYLHSEKK(gl)_
STK25 Ubiquitylation K197 -0.399 0.038 _LADFGVAGQLTDTQIK(gl)R_
STK25 Ubiquitylation K255 -0.986 _VLFLIPK(gl)NNPPTLVGDFTK_
STK25 Ubiquitylation K298 0.008 -0.419 _FIVK(gl)NSK_
STK25 Ubiquitylation K302 -0.101 0.068 _K(gl)TSYLTELIDR_
STK25 Ubiquitylation K420 -0.470 _SIAVAEAACPGITDK(gl)MVK_
STK25 Ubiquitylation K423 -0.470 -0.024 _SIAVAEAACPGITDKMVK(gl)_
STK3 Ubiquitylation K176 -0.350 _DIK(gl)AGNILLNTEGHAK_
STK3 Ubiquitylation K205 -0.223 -0.386 _LADFGVAGQLTDTMAK(gl)R_
STK3 Phosphorylation S344 0.416 0.115 _ELEEEEENS(ph)DEDELDSHTM(ox)VK_
STK3 Phosphorylation S344 0.573 0.366 _EMDQDDEENS(ph)EEDEMDSGTMVR_
STK3 Phosphorylation S413 0.603 1.205 _NATS(ph)PQVQRPSFMDYFDK_
STK3 Ubiquitylation K481 -0.782 _LK(gl)ALDPMMER_
STK39 Phosphorylation S385 0.711 _TEDGDWEWS(ph)DDEMDEKSEEGK_
STK4 Ubiquitylation K176 -0.350 _DIK(gl)AGNILLNTEGHAK_
STK4 Ubiquitylation K205 -0.223 -0.386 _LADFGVAGQLTDTMAK(gl)R_
STK4 Phosphorylation S320 0.555 0.552 _EVDQDDEENS(ph)EEDEMDSGTM(ox)VR_
STK4 Phosphorylation S344 0.573 0.366 _EMDQDDEENS(ph)EEDEMDSGTMVR_
STRADA Ubiquitylation K7 -0.518 _(ac)SFLVSK(gl)PER_
TAOK1 Phosphorylation S9 -0.793 0.108 _AGS(ph)LKDPEIAELFFKEDPEK_
TAOK1 Phosphorylation S421 -0.535 -0.355 _ASDPQS(ph)PPQVSR_
TAOK1 Ubiquitylation K587 0.700 _QEWLSK(gl)QK_
TAOK2 Phosphorylation S9 0.024 0.070 _AGS(ph)LKDPDVAELFFKDDPEK_
TAOK3 Phosphorylation S9 -0.793 0.108 _AGS(ph)LKDPEIAELFFKEDPEK_
TAOK3 Phosphorylation S324 0.159 0.189 _NGPLNES(ph)QEDEEDSEHGTSLNR_
TAOK3 Phosphorylation S421 -0.535 -0.355 _ASDPQS(ph)PPQVSR_
TAOK3 Ubiquitylation K587 0.700 _QEWLSK(gl)QK_
TBCK Ubiquitylation K756 -1.151 _ESIPLNDLK(gl)SEVSPR_
TBCK Phosphorylation S890 -0.025 0.175 _IKPTGLLTIPS(ph)PQI_
TGFBR1 Ubiquitylation K449 -0.991 _VVCEQK(gl)LRPNIPNR_
TGFBR1 Ubiquitylation K502 0.553 0.430 _TLSQLSQQEGIK(gl)M_
TLK1 Phosphorylation S741 0.299 _RS(ph)NSSGNLHMAGLTASPTPPSSSIITY_
TLK2 Phosphorylation T98 0.262 _ISDYFEFAGGSAPGT(ph)SPGR_
TLK2 Phosphorylation S99 0.267 -0.122 _ISDYFEFAGGSAPGTS(ph)PGR_
TNIK Phosphorylation S680 0.363 0.497 _TTSIS(ph)PALAR_
TNIK Phosphorylation S707 0.024 -0.032 _LGSQPIRAS(ph)NPDLR_
TNIK Phosphorylation S764 0.214 -0.395 _ANS(ph)KS(ph)EGSPVLPHEPAK_
TNIK Phosphorylation S766 -0.772 -0.395 _S(ph)EGSPVLPHEPAK_
TNIK Phosphorylation S769 -0.527 -0.660 _SEGS(ph)PVLPHEPAK_
TNIK Ubiquitylation K824 -0.222 _IEETNRPMK(gl)K_
TNIK Phosphorylation S954 1.646 _VSTHS(ph)QEMDSGTEYGMGSSTK_
TP53RK Phosphorylation T7 -0.376 _AT(ph)TPADGEEPAPEAEALAAAR_
TP53RK Phosphorylation T8 0.572 -0.177 _ATT(ph)PADGEEPAPEAEALAAAR_
TRIB1 Ubiquitylation K46 -2.031 -0.877 _LLDADDAAAVAAK(gl)CPR_
TRIO Phosphorylation S1723 0.798 _S(ph)SMEMEGIFNHK_
TRIO Phosphorylation S1724 0.798 _S(ph)SMEMEGIFNHK_
TRIO Phosphorylation S2455 0.012 -0.418 _AGAAS(ph)PLNSPLSSAVPSLGK_
TRIO Phosphorylation S2459 0.534 _AGAAS(ph)PLNS(ph)PLSSAVPSLGK_
TTK Phosphorylation S281 0.857 0.604 _VPVNLLNS(ph)PDCDVK_
TTK Phosphorylation S436 -0.403 -0.266 _HTTFEQPVFSVSKQS(ph)PPISTSK_
TTK Phosphorylation S821 -1.037 -0.693 _YVLGQLVGLNS(ph)PNSILK_
TTN Ubiquitylation K27327 -0.283 0.183 _AGEVLK(gl)INADIAGR_
TYRO3 Phosphorylation S930 0.766 -0.051 _YILTPGGLAEQPGQAEHQPES(ph)PLNETQR_
UHMK1 Ubiquitylation K383 0.050 _GQVFVEYANAGDSK(gl)AAQK_
ULK1 Phosphorylation S450 -0.237 -0.173 _NLQS(ph)PTQFQTPR_
ULK1 Phosphorylation T468 -0.247 0.456 _SGST(ph)SPLGFAR_
ULK1 Phosphorylation S469 0.035 0.470 _SGSTS(ph)PLGFAR_
ULK1 Phosphorylation S623 -0.793 -0.874 _NPLPPILGS(ph)PTK_
ULK1 Phosphorylation T625 -0.547 -0.776 _NPLPPILGSPT(ph)K_
ULK1 Phosphorylation T636 0.087 _T(ph)PSSQNLLALLAR_
ULK1 Phosphorylation S638 -0.154 0.598 _TPS(ph)SQNLLALLAR_
VRK1 Ubiquitylation K92 -0.698 _AAK(gl)PEQIQK_
VRK1 Ubiquitylation K106 -0.001 _LK(gl)YLGVPK_
VRK1 Ubiquitylation K301 0.185 -1.136 _NKPGEIAK(gl)YMETVK_
VRK3 Phosphorylation T58 0.081 _RGLNSSFET(ph)SPKK_
VRK3 Phosphorylation S59 -0.048 0.049 _RGLNSSFETS(ph)PK_
VRK3 Phosphorylation S83 0.463 0.688 _LSLFSDGDSS(ph)ESEDTLSSSER_
WEE1 Phosphorylation S139 -0.678 -0.613 _SPAAPYFLGSSFS(ph)PVR_
WNK1 Phosphorylation S2476 -0.727 -0.899 _KEGPVAS(ph)PPFMDLEQAVLPAVIPK_
WNK1 Phosphorylation S2503 -0.810 -0.764 _KEKPELSEPS(ph)HLNGPSSDPEAAFLSR_
WNK1 Phosphorylation S2509 -0.298 _KEKPELSEPSHLNGPS(ph)SDPEAAFLSR_
WNK1 Phosphorylation S2510 -0.532 -0.298 _KEKPELSEPSHLNGPSS(ph)DPEAAFLSR_
WNK1 Phosphorylation S2527 -0.349 _DVDDGSGS(ph)PHSPHQLSSK_
WNK1 Phosphorylation S2530 0.202 -0.225 _DVDDGSGSPHS(ph)PHQLSSK_
WNK2 Phosphorylation S1776 -1.152 _KRPEQQDVS(ph)SPAK_
WNK2 Phosphorylation S1777 -0.593 _KRPEQQDVSS(ph)PAK_
WNK2 Phosphorylation S2476 -0.727 -0.899 _KEGPVAS(ph)PPFMDLEQAVLPAVIPK_
WNK2 Phosphorylation S2503 -0.810 -0.764 _KEKPELSEPS(ph)HLNGPSSDPEAAFLSR_
WNK2 Phosphorylation S2509 -0.298 _KEKPELSEPSHLNGPS(ph)SDPEAAFLSR_
WNK2 Phosphorylation S2510 -0.532 -0.298 _KEKPELSEPSHLNGPSS(ph)DPEAAFLSR_
WNK2 Phosphorylation S2527 -0.349 _DVDDGSGS(ph)PHSPHQLSSK_
WNK2 Phosphorylation S2530 0.202 -0.225 _DVDDGSGSPHS(ph)PHQLSSK_
WNK3 Phosphorylation S2476 -0.727 -0.899 _KEGPVAS(ph)PPFMDLEQAVLPAVIPK_
WNK3 Phosphorylation S2503 -0.810 -0.764 _KEKPELSEPS(ph)HLNGPSSDPEAAFLSR_
WNK3 Phosphorylation S2509 -0.298 _KEKPELSEPSHLNGPS(ph)SDPEAAFLSR_
WNK3 Phosphorylation S2510 -0.532 -0.298 _KEKPELSEPSHLNGPSS(ph)DPEAAFLSR_
WNK3 Phosphorylation S2527 -0.349 _DVDDGSGS(ph)PHSPHQLSSK_
WNK3 Phosphorylation S2530 0.202 -0.225 _DVDDGSGSPHS(ph)PHQLSSK_
YES1 Phosphorylation T37 -0.435 _YRPENTPEPVSTSVSHYGAEPT(ph)TVSPCPSSSAK_
YES1 Ubiquitylation K191 -0.112 0.264 _ESETTK(gl)GAYSLSIR_
YES1 Ubiquitylation K235 0.323 _AQFDTLQK(gl)LVK_
YES1 Ubiquitylation K259 -1.613 _LTTVCPTVK(gl)PQTQGLAK_


© Copyright Svejstrup Laboratory 2015