bioLOGIC Data » bioLOGIC CategoryView » bioLOGIC VennView » Experimental Details »

bioLOGIC Category

Results for the Category
intracellular signal transduction
(GO:0035556)

RNAi screen result RNAPII IP (MG132) CSB IP CSB IP (MG132) Chrom. Chrom. (MG132) Ubi /Phospo Ubi /Phospho (MG132)
W

Protein Results:

 Results for post-translational modifications (below)
Gene name MGoogle Score RNAi high RNAi low RNAPII-IP (MG132) CSB-IP CSB-IP (MG132) Chrom. Chrom. (MG132)
ANP32A 3 0.570 -0.530 0.684 0.039 0.086
ANP32A 3 0.570 -0.530 0.786 2.075 0.133 0.666 0.114
MARK2 2 0.390 -0.570 -0.342 -0.924
GSK3B 2 1.020 -0.870 -1.128 1.091
SRPK1 2 -2.020 3.440
SRPK1 2 -2.020 3.440 -0.227 0.204
SRPK1 2 -2.020 3.440 1.541 -0.249 -0.327
MYO9B 2 0.820 -0.550
MAPK14 2 -0.160 -0.350
TNIK 2 -2.250 5.030 0.038 0.092 0.062
TNIK 2 -2.250 5.030 -0.852 -0.525
DFFA 2 -0.290 -0.220
DDX3X 2 -0.250 0.370 0.081 -0.794 -0.166 -0.062 -0.025
FYN 1 1.080 -1.100
FYN 1 1.080 -1.100
MAP4K5 1 -0.392
AKAP11 1
DEPDC1B 1 2.070 -1.130
WNK1 1 -2.390 5.600 0.546 0.639
WNK1 1 -0.180 0.010 0.546 0.639
DGKD 1 -1.930 3.220
SRPK3 1 -0.520 0.710 1.541 -0.249 -0.327
PRKAR1A 1 -0.550 0.230
PRKAR1A 1 -0.550 0.230
YWHAE 1 0.440 -0.380 1.095 -0.160
YWHAE 1 0.440 -0.380 1.129 0.621 0.321
WSB1 1 -2.230 5.080
ARHGEF2 1 -0.650 0.360 -0.121 -0.287 0.319 0.984 0.013
CIT 1 -1.740 3.570 -1.113 0.349
PLCG1 1 -0.170 0.000
ARFGEF2 1 -0.840 1.310 2.230
MCF2L 1 2.560 -1.220
PRKCSH 1 0.550 0.060 0.459 0.419
RAF1 1 2.020 -1.230
TNS3 1 -1.690 2.670
GCOM1 1 -1.580 2.760
ADCY3 1 -0.850 1.180
PSEN2 1 -1.820 3.280
APBB2 1 0.800 -0.750
STK17A 1 -2.380 4.520
AKAP13 1 -0.260 0.000
OXSR1 1 1.270 -0.800 -2.421 0.540 0.889
RPS6KA3 1 -1.550 2.890
LYN 1 -1.790 3.770
LYN 1 -1.790 3.770
DVL2 0 -0.050 0.580
PRKAR2B 0 -0.290 0.380
DEPDC1 0 -0.870 0.970
PRKCH 0 1.450 -1.320
ARHGEF5 0 -1.480 2.200
ARHGEF5 0 1.110 -0.980
KMT2C 0 0.730 0.280 -1.099 0.032 -0.195
TRAF3IP2 0 1.490 -1.010
WNK2 0 -0.660 0.130 0.546 0.639
WNK3 0 -0.110 -0.490 0.546 0.639
GUCY1B3 0 -0.550 -0.060
PRKCQ 0 0.410 0.020
MYO9A 0 1.440 -0.970
PRKCZ 0 -0.290 0.310
ROCK1 0 -1.420 2.380 -0.112 -0.732
MAP4K4 0 -0.500 0.030 0.038 0.092 0.062
MAP4K4 0 -0.500 0.030
RPS6KA6 0 -1.250 1.770
PAG1 0 -0.550 1.760
ARAF 0 0.550 -0.670
ARAF 0 0.550 -0.670
TOLLIP 0 -0.050 0.340 -0.613
TOLLIP 0 0.160 -0.150 -0.613
PSEN1 0 0.930 -1.110
MAGI3 0 1.510 -0.840
MAGI3 0 1.510 -0.840 0.696 0.967
STK17B 0 0.770 -0.450
MAP3K4 0 0.000 0.450
CRKL 0 0.290 -0.620
HMOX1 0 0.330 0.220 -1.817 -1.289
STK4 0 0.260 -0.240
STK4 0 0.260 -0.240
STK4 0 0.260 -0.240 -0.235 -0.851
PLCB4 0 0.640 -0.400
MCF2 0 -1.610 1.980
MTMR8 0 0.300 -0.810
ARHGEF7 0 -0.410 -0.070
DGKH 0 -1.220 0.820
STK3 0 -0.570 0.720
STK3 0 -0.570 0.720 -0.235 -0.851
PRKD2 0 0.050 0.170 0.914
PRKD2 0 0.050 0.170
FKBP8 0 -1.260 1.670 -0.042 0.441
FKBP8 0 -1.260 1.670 -1.108 -0.333 -1.072
HSPB1 0 0.710 -0.660 -0.632
PRKAG2 0 1.300 -0.990 0.278 -0.667
RAPGEF2 0 -0.860 1.560
STK38 0 -0.700 0.020 -0.949 -1.108 -0.051
PRKAR2A 0 -0.530 1.080 0.026 -1.317 -0.866 0.783 0.007
PRKAR2A 0 -0.530 1.080
ECT2 0 0.620 -0.960 -0.787
PLCH1 0 0.170 -0.190
PIKFYVE 0 -0.230 0.410
PRKD3 0 0.160 0.030
PRKD3 0 0.160 0.030
MARK1 0 -1.135
STMN1 0 0.260 0.050
STMN1 0 0.710 -0.560
STMN1 0 0.260 0.050
STMN1 0 0.710 -0.560
RPS6KA1 0 -0.160 -0.660
RPS6KA1 0 -0.160 -0.660
DUSP1 0 0.290 -0.100
ADCY7 0
SH3BP5 0 0.360 -0.060
INADL 0 -1.520 2.140 1.064 0.331
DCLK1 0 -1.340 1.710
DCLK1 0 -1.340 1.710
ROCK2 0 -1.660 2.330
SRPK2 0 -0.090 0.510 -0.634
RAPGEF5 0 0.540 -0.210
RAC1 0 -0.580 1.580 0.486 -0.364 -0.568
SDCBP 0 -1.190 2.010 -1.188 0.299
SDCBP 0 -1.190 2.010 -0.575
UNC13C 0 0.760 -0.550
ARHGAP29 0
PLCE1 0 0.540 -0.070
PDPK1 0 0.050 -0.440
KSR1 0 0.100 0.600
MINK1 0 -0.710 0.650 0.038 0.092 0.062
MINK1 0 -0.710 0.650
SIK1 0 0.130 -0.480
AKT1 0 -0.050 0.700
AKT1 0 0.860 -0.040
CNIH4 0 0.720 -0.670 -0.050 0.120
CDC42BPA 0 0.270 -0.540 0.369 0.295
TLK2 0 -0.170 -0.340 0.092
DLG5 0 -0.250 0.030
FER 0 0.540 -0.510 0.407
RASGRP3 0 0.570 0.240
CARHSP1 0 -0.530 -0.090
DGKE 0 -0.800 1.500 -0.239 0.518
PRKCA 0 0.750 -0.690 0.349 0.585
PRKCA 0 0.750 -0.690
PLCL2 0 -0.410 0.110
FMN2 0 0.380 -0.730
GRIP1 0 -0.360 0.430
BRAF 0
ABR 0 -1.000 1.510
DEDD2 0 0.690 -0.270
SQSTM1 0 -0.860 1.770 -2.165 -2.063 -1.741
SQSTM1 0 -0.440 0.530 -2.165 -2.063 -1.741
DVL3 0 0.890 -0.290
PLCD3 0 0.810 -0.250
RACGAP1 0 0.180 0.230 -0.308 -0.006
RACGAP1 0 1.070 -0.710 -0.308 -0.006
ADCY9 0 -0.910 0.930
JAK1 0 0.190 -0.100 -1.504 -0.381 -0.438
GPR155 0 -0.720 2.020
PRKCI 0 0.730 -0.460 1.483 0.192 0.350
PRKCD 0 0.250 0.070 0.578 0.427
WNK2 0 -0.660 0.130
PDZD8 0 -0.800 0.750 0.632 1.010
PRKCB 0 0.260 -0.530
PRKCB 0 0.260 -0.530 0.349 0.585
NSMCE1 0 0.000 -0.240 -2.531 0.668
DFFB 0 -0.200 -0.620
RAC3 0 0.210 0.290
NET1 0 -0.590 -0.370
ADCY6 0 -0.720 0.740
SMAD2 0
GSG2 0 1.490 -0.810
SH2B1 0 0.970 0.010
PLEKHM3 0 -0.060 -0.560
PLCB1 0 -0.300 -0.220
RGS7 0 0.820 -0.610
PRKD1 0 1.050 0.130
PRKD1 0 1.050 0.130
PRKD1 0 1.050 0.130
GNB1L 0 0.540 -0.860
RASA3 0 -0.690 1.590
BCR 0 -0.110 -0.410
BCR 0 0.680 -0.700
BCR 0 -0.110 -0.410 1.326
BCR 0 0.680 -0.700 1.326
DAPK1 0 -0.090 -0.480 -1.111
ARHGEF12 0 -0.650 0.190
SRC 0 0.050 0.470 -0.031
TLK1 0 1.190 -1.120
CDC42BPB 0 -1.290 1.790 0.546 0.645 0.683
ITSN1 0 -0.670 0.610
ITSN1 0 -0.670 0.610 0.287 0.672
STK38L 0 -1.050 1.050 -1.472 -0.993 0.116

PTM Sites:

 Back to Protein Results
Gene name PTM type PTM site UV UV (MG132) Sequence
ABR Phosphorylation S72 -1.041 -1.433 _SQGGGDGVS(ph)PTPPEGLAPGVEAGK_
ADCY3 Ubiquitylation K406 -0.885 _TK(gl)TGVDMR_
ADCY3 Ubiquitylation K628 0.051 _YSVEK(gl)EK_
ADCY3 Ubiquitylation K879 0.818 2.820 _IEVHDQK(gl)ER_
ADCY3 Ubiquitylation K1047 -1.036 _IGMNK(gl)GGVLAGVIGAR_
ADCY6 Phosphorylation S54 -1.434 -1.374 _DAEPPS(ph)PTPAGPPR_
ADCY6 Ubiquitylation K80 0.473 0.937 _GK(gl)ELGLR_
ADCY6 Ubiquitylation K568 1.007 0.799 _AMLAK(gl)LQR_
ADCY6 Phosphorylation S576 -0.020 _ANS(ph)MEGLMPR_
ADCY7 Ubiquitylation K477 0.660 _GDAALK(gl)MR_
ADCY9 Ubiquitylation K35 0.400 _INPK(gl)QLSSNSHPK_
ADCY9 Ubiquitylation K564 0.874 0.253 _LGQSVVADQLK(gl)GLK_
ADCY9 Ubiquitylation K622 0.176 0.287 _GQGTASSGNVSDLAQTVK(gl)TFDNLK_
ADCY9 Ubiquitylation K628 0.266 _TFDNLK(gl)TCPSCGITFAPK_
ADCY9 Ubiquitylation K699 1.085 _LTNSQTSLCEILQEK(gl)GR_
ADCY9 Ubiquitylation K1218 1.351 1.067 _VLSK(gl)MGYDFDYR_
AKAP11 Phosphorylation S422 -0.666 _KPES(ph)PYGNLCDAPDSPRPVK_
AKAP11 Phosphorylation S433 2.410 -1.010 _KPESPYGNLCDAPDS(ph)PRPVK_
AKAP11 Phosphorylation S444 0.263 _EDS(ph)GLFSPIR_
AKAP11 Phosphorylation S448 -0.067 0.353 _EDSGLFS(ph)PIR_
AKAP11 Phosphorylation S452 -0.481 _S(ph)SAFSPLGGCTPAECFCQTDIGGDR_
AKAP11 Ubiquitylation K608 -1.205 _AFSLK(gl)ER_
AKAP11 Phosphorylation S1169 0.094 -0.723 _S(ph)LSEEVESSESGELPEVDVK_
AKAP11 Phosphorylation S1171 0.094 0.172 _SLS(ph)EEVESSESGELPEVDVK_
AKAP11 Phosphorylation S1242 -0.029 -0.496 _SVS(ph)PTFLNPSDENLK_
AKAP11 Phosphorylation S1337 -0.105 0.380 _YPS(ph)CESVTDEYAGHLIQILK_
AKAP11 Phosphorylation S1580 2.060 _VTYAEKLS(ph)PLTGQACR_
AKAP13 Phosphorylation S1407 0.033 _ENWCTIEPCPDAASLLAS(ph)KQSPECENFLDVGLGR_
AKAP13 Phosphorylation S1645 0.260 0.639 _VDS(ph)LVSLSEEDLESDQR_
AKAP13 Phosphorylation S1650 1.957 1.098 _VDSLVSLS(ph)EEDLESDQR_
AKAP13 Phosphorylation S1879 -0.267 -0.048 _S(ph)AVLLVDETATTPIFANR_
AKAP13 Phosphorylation S1932 0.162 0.318 _FLSHS(ph)TDSLNK_
AKAP13 Phosphorylation S2401 -0.038 _DMAECSTPLPEDCS(ph)PTHSPR_
AKAP13 Phosphorylation S2564 0.644 0.859 _S(ph)LSRPSSLIEQEK_
AKAP13 Phosphorylation S2566 0.600 0.289 _SLS(ph)RPSSLIEQEK_
AKAP13 Phosphorylation S2712 -1.063 _IPSFFPSPEEPPS(ph)PSAPSIAK_
AKAP13 Phosphorylation S2721 1.298 1.110 _S(ph)GSLDSELSVSPK_
AKAP13 Phosphorylation S2731 -0.105 0.196 _SGSLDSELSVS(ph)PK_
AKT1 Phosphorylation S124 0.252 0.311 _SGS(ph)PSDNSGAEEMEVSLAKPK_
AKT1 Phosphorylation S126 -0.241 _SGSPS(ph)DNSGAEEM(ox)EVSLAK_
AKT1 Ubiquitylation K301 0.988 _EGIK(gl)DGATMK_
ANP32A Phosphorylation T15 1.827 _NRT(ph)PSDVKELVLDNSR_
ANP32A Phosphorylation S17 2.531 1.912 _NRTPS(ph)DVKELVLDNSR_
ANP32A Ubiquitylation K20 -0.752 -1.672 _TPSDVK(gl)ELVLDNSR_
ANP32A Ubiquitylation K99 -0.126 _CPNLTHLNLSGNK(gl)IK_
ANP32A Ubiquitylation K101 -0.043 _CPNLTHLNLSGNKIK(gl)_
ANP32A Ubiquitylation K101 -0.797 _LK(gl)DISTLEPLKK_
ANP32A Ubiquitylation K110 -1.410 _DLSTIEPLK(gl)K_
ANP32A Ubiquitylation K111 -0.906 -1.410 _DLSTIEPLKK(gl)_
ANP32A Ubiquitylation K111 -0.207 _LKDISTLEPLKK(gl)_
APBB2 Phosphorylation S123 1.522 1.336 _NLS(ph)PTAVINITSEK_
ARAF Phosphorylation T227 0.017 _STSTPNVHMVSTT(ph)APMDSNLIQLTGQSFSTDAAGSR_
ARAF Phosphorylation S260 0.245 _GS(ph)PSPASVSSGR_
ARAF Ubiquitylation K543 -1.068 -0.962 _ISSNCPK(gl)AMR_
ARAF Phosphorylation S621 0.212 0.271 _SAS(ph)EPSLHR_
ARFGEF2 Phosphorylation S214 0.250 _ELEKPIQS(ph)KPQSPVIQAAAVS(ph)PK_
ARFGEF2 Phosphorylation S218 -0.081 0.177 _ELEKPIQSKPQS(ph)PVIQAAAVS(ph)PK_
ARFGEF2 Phosphorylation S227 -1.086 -0.941 _ELEKPIQSKPQS(ph)PVIQAAAVS(ph)PK_
ARFGEF2 Phosphorylation S276 0.922 0.963 _GS(ph)SLSGTDDGAQEVVK_
ARFGEF2 Phosphorylation S277 0.851 0.904 _GSS(ph)LSGTDDGAQEVVK_
ARFGEF2 Phosphorylation S1528 -0.424 0.473 _GQSQLS(ph)NPTDDSWK_
ARHGAP29 Phosphorylation S356 -0.303 -0.324 _AEEEHLSS(ph)SGGLAK_
ARHGAP29 Phosphorylation S357 0.264 -0.678 _AEEEHLSSS(ph)GGLAK_
ARHGAP29 Phosphorylation S499 -0.029 -0.292 _HLNSSQPSGFGPANS(ph)LEDVVR_
ARHGAP29 Phosphorylation S913 0.107 _IFDGSLQPQDVMCSIGVVDQGCFPKPLLS(ph)PEER_
ARHGAP29 Phosphorylation S949 0.431 0.427 _ATS(ph)FEESER_
ARHGAP29 Phosphorylation S1029 -0.612 -0.622 _LLLAS(ph)PPNER_
ARHGEF12 Phosphorylation S190 1.083 _ITS(ph)PVLMGEENNVVHNQK_
ARHGEF12 Phosphorylation S309 -0.158 -0.113 _TDCSSGDASRPSSDNADS(ph)PK_
ARHGEF12 Phosphorylation S341 1.105 0.912 _SETIQDTDTQSLVGS(ph)PSTR_
ARHGEF12 Phosphorylation S635 -0.423 _HLSTPSS(ph)VSPEPQDSAK_
ARHGEF12 Phosphorylation S637 -0.340 -0.384 _HLSTPSSVS(ph)PEPQDSAK_
ARHGEF12 Phosphorylation T736 -0.667 -0.391 _VTEHGT(ph)PKPFR_
ARHGEF12 Phosphorylation T1286 0.415 0.112 _T(ph)ASQGPQTDSVIQNSENIK_
ARHGEF12 Phosphorylation S1288 0.339 0.153 _TAS(ph)QGPQTDSVIQNSENIK_
ARHGEF2 Phosphorylation S196 -0.074 0.190 _SVS(ph)TTNIAGHFNDESPLGLR_
ARHGEF2 Phosphorylation S208 -1.192 _SVSTTNIAGHFNDES(ph)PLGLR_
ARHGEF2 Phosphorylation S217 0.850 _ILS(ph)QSTDSLNMR_
ARHGEF2 Phosphorylation S219 0.334 0.620 _ILSQS(ph)TDSLNMR_
ARHGEF2 Ubiquitylation K397 -0.617 _LYK(gl)ELYAR_
ARHGEF2 Phosphorylation S689 2.510 1.206 _SES(ph)LESPR_
ARHGEF2 Phosphorylation S735 -0.212 _EPALPLEPDS(ph)GGNTSPGVTANGEAR_
ARHGEF2 Phosphorylation T739 -0.489 _EPALPLEPDSGGNT(ph)SPGVTANGEAR_
ARHGEF2 Phosphorylation S740 -0.461 -0.375 _EPALPLEPDSGGNTS(ph)PGVTANGEAR_
ARHGEF2 Phosphorylation S930 -0.782 -1.060 _S(ph)LPAGDALYLSFNPPQPSR_
ARHGEF2 Phosphorylation S976 0.649 0.809 _QELGS(ph)PEER_
ARHGEF5 Phosphorylation S11 -0.663 -0.620 _GAS(ph)PPISAIEEFSIIPEAPM(ox)R_
ARHGEF5 Phosphorylation S445 -1.196 _AEELS(ph)PAALSPSLEPIR_
ARHGEF5 Phosphorylation S662 -1.059 0.313 _DYSTVSAS(ph)PTALSTLK_
ARHGEF5 Phosphorylation T1121 -0.492 _LESLSET(ph)PGPSSPR_
ARHGEF5 Phosphorylation S1125 -0.288 -0.574 _LESLSETPGPS(ph)SPR_
ARHGEF5 Phosphorylation S1126 -0.717 _LESLSETPGPSS(ph)PR_
ARHGEF7 Phosphorylation S50 1.374 1.424 _IKS(ph)FDSLGSQSLHTR_
ARHGEF7 Phosphorylation S154 -0.198 0.140 _SGTLKS(ph)PPK_
ARHGEF7 Phosphorylation S415 0.662 0.947 _M(ox)S(ph)GFIYQGK_
ARHGEF7 Phosphorylation S600 0.797 _S(ph)TAALEEDAQILK_
ARHGEF7 Phosphorylation T601 0.797 _S(ph)TAALEEDAQILK_
ARHGEF7 Phosphorylation S635 0.061 -0.203 _KES(ph)APQVLLPEEEKIIVEETK_
BCR Phosphorylation S122 -1.850 -1.388 _ASASRPQPAPADGADPPPAEEPEARPDGEGS(ph)PGK_
BCR Phosphorylation S354 -0.057 0.015 _VS(ph)PSPTTYR_
BCR Phosphorylation S459 -0.638 -0.740 _HQDGLPYIDDS(ph)PSSSPHLSSK_
BCR Phosphorylation S1035 0.931 1.055 _LSVKFNS(ph)R_
BCR Ubiquitylation K1066 0.971 _SK(gl)VPYIVR_
BRAF Phosphorylation S151 -0.685 -0.629 _SNPKS(ph)PQKPIVR_
BRAF Phosphorylation S363 -0.023 -0.241 _S(ph)SSAPNVHINTIEPVNIDDLIR_
BRAF Phosphorylation S365 -0.286 0.012 _SSS(ph)APNVHINTIEPVNIDDLIR_
BRAF Phosphorylation S399 -0.890 -0.527 _GDGGSTTGLS(ph)ATPPASLPGSLTNVK_
BRAF Phosphorylation T401 -0.525 _GDGGSTTGLSAT(ph)PPASLPGSLTNVK_
BRAF Phosphorylation S446 0.246 0.349 _RDS(ph)SDDWEIPDGQITVGQR_
BRAF Phosphorylation S447 0.579 0.623 _RDSS(ph)DDWEIPDGQITVGQR_
BRAF Phosphorylation S729 0.208 0.219 _SAS(ph)EPSLNR_
CARHSP1 Phosphorylation T23 -1.239 -2.277 _(ac)SSEPPPPPQPPTHQASVGLLDT(ph)PR_
CARHSP1 Phosphorylation S26 -1.033 -1.560 _(ac)SSEPPPPPQPPTHQASVGLLDTPRS(ph)R_
CARHSP1 Phosphorylation S30 0.050 0.327 _ERS(ph)PSPLR_
CARHSP1 Phosphorylation S41 -0.388 -0.186 _GNVVPS(ph)PLPTR_
CARHSP1 Phosphorylation T45 -0.361 -0.197 _GNVVPSPLPT(ph)RR_
CARHSP1 Phosphorylation S52 0.962 1.077 _TFS(ph)ATVR_
CARHSP1 Ubiquitylation K64 -0.088 0.450 _ASQGPVYK(gl)GVCK_
CDC42BPA Phosphorylation S1545 0.686 _RYS(ph)FRVPEEER_
CDC42BPA Phosphorylation S1629 0.643 0.973 _SMS(ph)ASSGLSAR_
CDC42BPA Phosphorylation S1651 0.478 0.828 _EFS(ph)GGSYSAK_
CDC42BPA Phosphorylation S1721 1.103 1.216 _SLS(ph)LESTDR_
CDC42BPB Ubiquitylation K338 -0.347 _LGQNGIEDFKK(gl)_
CDC42BPB Ubiquitylation K426 0.566 _SIMQSNTLTK(gl)DEDVQR_
CDC42BPB Phosphorylation S481 0.701 0.480 _ALSNS(ph)NRDKEIK_
CDC42BPB Ubiquitylation K1337 1.400 1.105 _GCQLMATATLK(gl)R_
CDC42BPB Phosphorylation S1690 -1.711 -2.133 _HSTPSNSSNPSGPPS(ph)PNSPHR_
CIT Phosphorylation S440 0.108 -0.025 _SESVVSGLDS(ph)PAK_
CIT Phosphorylation S1940 -2.591 _VASS(ph)PAPPEGPSHPR_
CIT Phosphorylation S1971 0.032 _DKS(ph)PGRPLER_
CRKL Phosphorylation S41 0.868 _DS(ph)STCPGDYVLSVSENSR_
CRKL Phosphorylation S107 -0.818 -1.177 _YPS(ph)PPMGSVSAPNLPTAEDNLEYVR_
DAPK1 Ubiquitylation K939 0.937 0.001 _LFVLDAGASGSK(gl)DMK_
DCLK1 Phosphorylation S32 0.456 0.202 _VNGLPS(ph)PTHSAHCSFYR_
DCLK1 Phosphorylation T336 -1.793 _SPSPSPT(ph)SPGSLR_
DCLK1 Phosphorylation S337 -0.893 -0.694 _SPSPSPTS(ph)PGSLR_
DCLK1 Phosphorylation S352 0.641 0.487 _SSQHGGS(ph)STSLASTK_
DCLK1 Phosphorylation S352 0.103 0.523 _DLYRPLS(ph)SDDLDSVGDSV_
DCLK1 Phosphorylation S353 0.566 _DLYRPLSS(ph)DDLDSVGDSV_
DDX3X Ubiquitylation K78 1.311 _DK(gl)DAYSSFGSR_
DDX3X Ubiquitylation K93 0.657 1.846 _GK(gl)SSFFSDR_
DDX3X Phosphorylation S94 0.172 _S(ph)SFFSDRGSGSR_
DDX3X Phosphorylation S102 0.008 0.230 _SSFFSDRGS(ph)GSR_
DDX3X Phosphorylation S104 -0.231 0.320 _SSFFSDRGSGS(ph)R_
DDX3X Ubiquitylation K130 1.572 1.502 _SGFGK(gl)FER_
DDX3X Ubiquitylation K347 -0.406 0.360 _GK(gl)IGLDFCK_
DDX3X Ubiquitylation K503 -0.796 _SGK(gl)SPILVATAVAAR_
DDX3X Phosphorylation S602 -0.349 _S(ph)SRFSGGFGAR_
DDX3X Phosphorylation S603 -0.330 _SS(ph)RFSGGFGAR_
DDX3X Phosphorylation S606 -0.248 -0.447 _FS(ph)GGFGAR_
DEDD2 Ubiquitylation K193 -2.121 _GAPAAPQQQSEPARPSSEGK(gl)VTCDIR_
DEPDC1 Ubiquitylation K113 -3.374 _FPATSPLK(gl)TLPR_
DEPDC1 Ubiquitylation K777 -0.155 _EYPLIYQK(gl)R_
DEPDC1B Phosphorylation S160 -1.267 _RHS(ph)IAIGEVPACR_
DFFA Phosphorylation S28 2.697 2.074 _NYS(ph)REQHGVAASCLEDLR_
DFFA Phosphorylation S37 -0.697 -0.347 _EQHGVAAS(ph)CLEDLR_
DFFA Ubiquitylation K208 -0.111 _EGSLLSK(gl)QEESK_
DFFA Phosphorylation S315 -0.237 -0.360 _AS(ph)PPGDLQNPK_
DFFB Ubiquitylation K176 -0.696 _FQSK(gl)SGYLR_
DGKD Phosphorylation S56 0.319 0.732 _KVS(ph)TSGQIR_
DGKE Ubiquitylation K212 -0.965 _TDYEVLASK(gl)LGK_
DGKE Ubiquitylation K357 -0.396 0.179 _VQVTNK(gl)GYYNLR_
DGKH Phosphorylation S56 0.319 0.732 _KVS(ph)TSGQIR_
DLG5 Ubiquitylation K63 -0.246 _LLLAK(gl)ER_
DLG5 Phosphorylation S132 -1.278 -1.199 _APS(ph)PPPLLTDQQVNEK_
DLG5 Phosphorylation S1254 0.219 _ATHGSNS(ph)LPSSAR_
DUSP1 Ubiquitylation K97 -0.523 _SAALDGAK(gl)R_
DVL2 Ubiquitylation K343 0.846 -1.366 _DIVHK(gl)PGPIVLTVAK_
DVL3 Phosphorylation S112 -0.787 _TGGIGDS(ph)RPPSFHPHAGGGSQENLDNDTETDSLVSAQR_
DVL3 Phosphorylation S125 -0.854 -0.531 _TGGIGDSRPPSFHPHAGGGS(ph)QENLDNDTETDSLVSAQR_
FKBP8 Ubiquitylation K217 -0.362 -0.356 _VK(gl)CLNNLAASQLK_
FKBP8 Ubiquitylation K258 -0.292 _GK(gl)VLAQQGEYSEAIPILR_
FKBP8 Ubiquitylation K278 -1.013 -0.590 _AALK(gl)LEPSNK_
FKBP8 Ubiquitylation K284 -0.086 _LEPSNK(gl)TIHAELSK_
FMN2 Phosphorylation S295 -1.749 -2.453 _EPQQPPS(ph)PGGLPVSEAPSLPAAQPAAK_
FMN2 Phosphorylation T345 0.107 -0.012 _GAGDT(ph)DEEGEEDAFEDAPR_
FMN2 Phosphorylation S361 0.049 0.035 _GS(ph)PGEEWAPEVGEDAPQR_
FMN2 Phosphorylation S400 -1.708 -1.608 _LGEEPEEEAQGPDAPAAASLPGS(ph)PAPSQR_
FMN2 Phosphorylation S404 -1.476 _LGEEPEEEAQGPDAPAAASLPGSPAPS(ph)QR_
FMN2 Phosphorylation S482 0.879 1.050 _S(ph)ADWTEELGAR_
FYN Ubiquitylation K13 0.286 _DKEATK(gl)LTEER_
FYN Phosphorylation S21 0.373 0.731 _DGS(ph)LNQSSGYR_
FYN Ubiquitylation K259 0.921 _LTDLSVK(gl)TK_
FYN Ubiquitylation K261 0.099 _LTDLSVKTK(gl)_
FYN Ubiquitylation K273 6.025 _SLCLEKK(gl)_
FYN Ubiquitylation K275 -0.521 _ESLQLIK(gl)R_
GCOM1 Phosphorylation S575 1.290 _VS(ph)SQAEDTSSSFDNLFIDR_
GCOM1 Phosphorylation S667 0.502 0.499 _SGS(ph)PISSEERR_
GNB1L Ubiquitylation K155 -0.889 _TSVCALK(gl)PK_
GPR155 Ubiquitylation K71 -0.073 _ANVITSTQAK(gl)GLGNFVSR_
GRIP1 Phosphorylation S43 0.361 0.201 _RQS(ph)IPEEFK_
GRIP1 Phosphorylation S847 0.159 0.098 _GSLS(ph)PVTKPR_
GSG2 Phosphorylation S143 0.253 _DS(ph)GRLSPDLSVCGQPR_
GSG2 Phosphorylation S147 0.018 0.645 _DSGRLS(ph)PDLSVCGQPR_
GSK3B Phosphorylation S9 -0.483 0.010 _TTS(ph)FAESCKPVQQPSAFGSMK_
GSK3B Ubiquitylation K85 -0.204 _LCDSGELVAIK(gl)K_
GSK3B Ubiquitylation K86 -0.204 _LCDSGELVAIK(gl)K_
GSK3B Phosphorylation S215 0.296 0.477 _GEPNVS(ph)YICSR_
GSK3B Phosphorylation Y216 0.356 0.376 _GEPNVSY(ph)ICSR_
GSK3B Phosphorylation T390 2.800 2.527 _IQAAAST(ph)PTNATAASDANTGDR_
GUCY1B3 Ubiquitylation K237 -0.565 _ISPYTFCK(gl)_
GUCY1B3 Ubiquitylation K583 1.401 _GK(gl)INVSEYTYR_
HMOX1 Ubiquitylation K243 -0.972 _ASNK(gl)VQDSAPVETPR_
HMOX1 Ubiquitylation K256 -1.769 _GK(gl)PPLNTR_
HSPB1 Phosphorylation S82 1.036 0.723 _QLS(ph)SGVSEIR_
HSPB1 Ubiquitylation K198 -1.654 _AQLGGPEAAK(gl)SDETAAK_
INADL Phosphorylation T335 0.065 -0.131 _DPAGDISVT(ph)PPAPAALPVALPTVASK_
INADL Phosphorylation T1209 0.020 _ALT(ph)DDSDENEEEDAFTDQK_
INADL Phosphorylation S1212 0.792 0.370 _ALTDDS(ph)DENEEEDAFTDQK_
ITSN1 Phosphorylation S203 -0.497 -0.811 _AQS(ph)FDVASVPPVAEWAVPQSSR_
ITSN1 Phosphorylation S313 0.882 0.188 _S(ph)GSGISVISSTSVDQR_
ITSN1 Phosphorylation S315 0.675 0.750 _SGS(ph)GISVISSTSVDQR_
ITSN1 Ubiquitylation K569 0.570 _DSLVTLK(gl)R_
ITSN1 Ubiquitylation K583 0.151 _NMQFSNTPDSGVSLLHK(gl)K_
ITSN1 Ubiquitylation K584 -0.412 _NMQFSNTPDSGVSLLHKK(gl)_
ITSN1 Ubiquitylation K596 1.277 _LK(gl)EQLDALEK_
ITSN1 Phosphorylation S889 -0.357 -0.319 _TVSPGSVS(ph)PIHGQGQVVENLK_
ITSN1 Phosphorylation S904 -0.681 -0.729 _SAFTPATATGSSPS(ph)PVLGQGEK_
ITSN1 Phosphorylation S978 1.075 0.684 _STS(ph)MDSGSSESPASLK_
JAK1 Ubiquitylation K227 -0.405 _YIPETLNK(gl)SIR_
JAK1 Ubiquitylation K249 0.116 0.771 _DFLK(gl)EFNNK_
JAK1 Ubiquitylation K559 -0.478 _EISNLLVATK(gl)K_
KMT2C Phosphorylation S2811 0.831 0.317 _TLVLSDKHS(ph)PQK_
KMT2C Phosphorylation S4034 -1.421 -1.557 _EEPPEPVPS(ph)PIIPILPSTAGK_
KSR1 Phosphorylation S334 0.052 _FDLSHGS(ph)PQMVR_
KSR1 Phosphorylation S406 -0.052 -0.067 _RTES(ph)VPSDINNPVDR_
KSR1 Phosphorylation S569 -0.413 -0.383 _ADVLEAHEAEAEEPEAGKS(ph)EAEDDEDEVDDLPSSR_
LYN Ubiquitylation K20 -0.592 _GKDSLSDDGVDLK(gl)TQPVR_
LYN Ubiquitylation K40 0.100 _DPTSNK(gl)QQRPVPESQLLPGQR_
LYN Phosphorylation S104 0.944 0.841 _DSLS(ph)DDGVDLK_
LYN Ubiquitylation K213 0.441 _HYQK(gl)QADGLCR_
LYN Ubiquitylation K477 -0.191 _VENCPDELYDIMK(gl)MCWK_
MAGI3 Phosphorylation S722 -0.403 _S(ph)GSPKLDPSEVYLK_
MAGI3 Phosphorylation S724 -0.403 _SGS(ph)PKLDPSEVYLK_
MAP3K4 Ubiquitylation K406 0.367 _DLNQK(gl)LR_
MAP3K4 Phosphorylation S1252 -0.654 _HSS(ph)PTEERDEPAYPR_
MAP4K4 Phosphorylation T704 0.480 0.190 _T(ph)TSRSPVLSR_
MAP4K4 Phosphorylation S706 0.353 0.381 _TTS(ph)RSPVLSR_
MAP4K4 Phosphorylation S708 0.247 0.386 _TTSRS(ph)PVLSR_
MAP4K4 Phosphorylation S716 0.989 -0.508 _RDS(ph)PLQGSGQQNSQAGQR_
MAP4K4 Phosphorylation S981 -0.167 -1.787 _KGS(ph)VVNVNPTNTRPQSDTPEIR_
MAP4K5 Ubiquitylation K36 1.547 _VGSGTYGDVYK(gl)AR_
MAPK14 Phosphorylation S2 3.221 3.623 _(ac)S(ph)QERPTFYR_
MAPK14 Phosphorylation T180 0.958 1.087 _HTDDEM(ox)T(ph)GYVATR_
MAPK14 Phosphorylation Y182 1.388 1.374 _HTDDEM(ox)TGY(ph)VATR_
MAPK14 Ubiquitylation K249 0.073 -1.380 _LVGTPGAELLKK(gl)_
MARK1 Phosphorylation S403 -1.363 -0.680 _SRPSSDLNNSTLQS(ph)PAHLK_
MARK2 Phosphorylation S387 3.794 _PSADLTNSS(ph)APSPSHK_
MARK2 Phosphorylation S390 5.149 4.932 _PSADLTNSSAPS(ph)PSHK_
MARK2 Phosphorylation S456 -1.253 -1.182 _VPAS(ph)PLPGLER_
MARK2 Phosphorylation S486 -0.028 0.163 _SRNS(ph)PLLER_
MARK2 Phosphorylation S569 -0.860 -0.742 _VPVAS(ph)PSAHNISSSGGAPDR_
MARK2 Phosphorylation S571 -0.724 _VPVASPS(ph)AHNISSSGGAPDR_
MCF2 Ubiquitylation K546 0.553 0.452 _(ac)VQM(ox)K(gl)TIQLK(gl)_
MCF2 Ubiquitylation K551 0.553 0.452 _(ac)VQM(ox)K(gl)TIQLK(gl)_
MCF2L Phosphorylation S90 -0.968 -0.792 _ALEQSQS(ph)LPLPAPT(ph)STSPSR_
MCF2L Phosphorylation S100 -0.927 -0.748 _ALEQSQSLPLPAPTSTS(ph)PSR_
MINK1 Phosphorylation S763 0.045 -0.277 _SDSVLPASHGHLPQAGS(ph)LER_
MTMR8 Ubiquitylation K13 -1.591 _VENVK(gl)LVDR_
MTMR8 Ubiquitylation K255 -0.134 _AAGK(gl)GYENEDNYANIR_
MYO9A Phosphorylation S1299 0.760 1.145 _SLGGIS(ph)PSEDRR_
MYO9A Phosphorylation S1829 0.062 _EFKENKEPS(ph)PK_
MYO9A Phosphorylation S2464 -0.455 0.730 _AAS(ph)GNEALGM(ox)EGPLGQTK_
MYO9B Phosphorylation S717 0.375 _AAGMSS(ph)PGAQSHPEELPR_
MYO9B Phosphorylation S1261 -1.739 -2.057 _VS(ph)PPAPGSAPETPEDK_
MYO9B Phosphorylation S1267 -0.114 -0.387 _VSPPAPGS(ph)APET(ph)PEDK_
MYO9B Phosphorylation T1271 -0.114 -0.387 _VSPPAPGS(ph)APET(ph)PEDK_
MYO9B Phosphorylation S1290 0.761 0.703 _VQEKPDS(ph)PGGSTQIQR_
MYO9B Phosphorylation S1354 0.955 0.892 _RTS(ph)FSTSDVSK_
MYO9B Phosphorylation S1405 1.890 1.745 _KKPGDASSLPDAGLS(ph)PGSQVDSK_
MYO9B Phosphorylation S1992 -0.221 0.324 _GS(ph)DEENLDSETSASTESLLEER_
NET1 Phosphorylation S50 -0.104 -0.386 _RAS(ph)GLSTEGATGPSADTSGSELDGR_
NET1 Phosphorylation T82 -0.341 _GSSFT(ph)FLTPGPNWDFTLK_
NET1 Ubiquitylation K166 -2.339 _SPASAQK(gl)FSSR_
NET1 Ubiquitylation K223 -1.722 _GEQDLIEDLK(gl)LAR_
NET1 Ubiquitylation K310 -2.114 _ALLDQKK(gl)_
NSMCE1 Ubiquitylation K143 -1.036 _K(gl)KEAEQVLQK_
NSMCE1 Ubiquitylation K144 -1.036 _K(gl)KEAEQVLQK_
OXSR1 Ubiquitylation K303 -0.098 _NKEFLQEK(gl)TLQR_
OXSR1 Phosphorylation S425 3.178 _TAQALSSGS(ph)GSQETK_
OXSR1 Phosphorylation S427 2.571 _TAQALSSGSGS(ph)QETK_
PAG1 Phosphorylation S288 0.574 0.875 _EGGEAEESATDTTS(ph)ETNK_
PDPK1 Phosphorylation S241 0.358 0.361 _ANS(ph)FVGTAQYVSPELLTEK_
PDPK1 Ubiquitylation K257 0.571 -0.234 _ANSFVGTAQYVSPELLTEK(gl)SACK_
PDZD8 Phosphorylation S521 -0.443 -0.226 _AQNEFKDEAQSLSHS(ph)PK_
PDZD8 Phosphorylation S538 -0.715 -0.584 _VPTTLSIKPLGAIS(ph)PVLNR_
PDZD8 Phosphorylation S967 -1.580 _LSEPGTDLVEPS(ph)PK_
PIKFYVE Phosphorylation S307 0.463 0.429 _SAS(ph)ITNLSLDR_
PIKFYVE Phosphorylation S1714 -0.557 _SSS(ph)PIRLPEMSGGQTNR_
PIKFYVE Phosphorylation S1754 -0.097 0.057 _GTAGKS(ph)PDLSSQK_
PLCB1 Phosphorylation S1199 -0.494 _TPS(ph)SEELGGDIPGKEFDTPL_
PLCB1 Phosphorylation S1200 -0.483 _TPSS(ph)EELGGDIPGKEFDTPL_
PLCB4 Ubiquitylation K284 1.083 0.038 _K(gl)GLISSDGFCR_
PLCD3 Ubiquitylation K205 0.167 -0.183 _MSFK(gl)EIK_
PLCD3 Phosphorylation S496 0.167 0.537 _ALS(ph)DREEEEEDDEEEEEEVEAAAQR_
PLCE1 Phosphorylation S1096 -0.120 0.294 _GES(ph)GEVTDDEMATR_
PLCG1 Ubiquitylation K300 8.031 _DLK(gl)NMLSQVNYR_
PLCG1 Ubiquitylation K348 -0.219 _SLMYSAQK(gl)TMDLPFLEASTLR_
PLCG1 Ubiquitylation K552 -0.355 _NMAQYFK(gl)K_
PLCG1 Ubiquitylation K553 -0.355 _NMAQYFK(gl)K_
PLCG1 Ubiquitylation K1063 0.864 0.355 _LTEGK(gl)IMER_
PLCG1 Phosphorylation S1370 0.475 0.515 _AREGS(ph)FESR_
PLCH1 Phosphorylation S1307 -0.570 -0.513 _TAALESNLPGS(ph)PNTSR_
PLCL2 Phosphorylation S17 -0.659 -0.349 _GGAAGGALPTS(ph)PGPALGAK_
PLCL2 Phosphorylation T584 0.372 0.633 _LSSNCSGVEGDVT(ph)DEDEGAEMSQR_
PLCL2 Phosphorylation S1113 -1.348 0.203 _S(ph)LEVIPEKANDETGE_
PLEKHM3 Ubiquitylation K68 1.157 _NVTSLGK(gl)GGMIWDHCK_
PLEKHM3 Ubiquitylation K77 0.842 _GGMIWDHCK(gl)SR_
PLEKHM3 Ubiquitylation K84 0.169 0.476 _LLETK(gl)AQNVFPAK_
PLEKHM3 Ubiquitylation K92 0.073 0.023 _AQNVFPAK(gl)EQFMVQR_
PLEKHM3 Ubiquitylation K144 -0.685 _SVNDLLDETSTFK(gl)PGHAR_
PRKAG2 Ubiquitylation K78 -0.588 _AAPLWDSK(gl)K_
PRKAG2 Ubiquitylation K79 -0.588 _AAPLWDSK(gl)K_
PRKAG2 Ubiquitylation K243 -0.525 -0.505 _VSALPVVDEK(gl)GR_
PRKAR1A Ubiquitylation K63 -1.895 _LEKEEAK(gl)QIQNLQK_
PRKAR1A Ubiquitylation K70 -0.869 0.073 _QIQNLQK(gl)AGTR_
PRKAR1A Phosphorylation S83 -0.969 -0.776 _EDEIS(ph)PPPPNPVVK_
PRKAR1A Ubiquitylation K92 -3.269 -2.395 _TDSREDEISPPPPNPVVK(gl)GR_
PRKAR1A Ubiquitylation K222 0.412 0.536 _TNVK(gl)LWGIDR_
PRKAR1A Ubiquitylation K244 -0.384 3.721 _K(gl)MYEEFLSK_
PRKAR1A Ubiquitylation K261 -0.886 _VSILESLDK(gl)WER_
PRKAR1A Ubiquitylation K346 0.329 _GPLK(gl)CVK_
PRKAR1A Ubiquitylation K349 -0.425 -0.103 _CVK(gl)LDRPR_
PRKAR1A Ubiquitylation K367 -0.939 0.044 _VLGPCSDILK(gl)R_
PRKAR2A Phosphorylation S99 0.020 0.056 _RVS(ph)VCAETYNPDEEEEDTDPR_
PRKAR2A Phosphorylation T104 -0.175 _RVSVCAET(ph)YNPDEEEEDTDPR_
PRKAR2A Ubiquitylation K359 0.640 _GQYFGELALVTNK(gl)PR_
PRKAR2B Phosphorylation T69 -0.367 _TWGDLGAAAGGGT(ph)PSK_
PRKAR2B Phosphorylation S114 0.366 0.525 _RAS(ph)VCAEAYNPDEEEDDAESR_
PRKAR2B Ubiquitylation K359 0.640 _GQYFGELALVTNK(gl)PR_
PRKCA Phosphorylation S10 -0.650 0.036 _(ac)ADVFPGNDS(ph)TASQDVANR_
PRKCA Phosphorylation S13 -1.038 0.335 _(ac)ADVFPGNDSTAS(ph)QDVANR_
PRKCA Phosphorylation S226 0.693 0.415 _STLNPQWNES(ph)FTFK_
PRKCA Ubiquitylation K316 -0.522 -0.535 _LGPAGNK(gl)VISPSEDR_
PRKCB Phosphorylation S10 -0.650 0.036 _(ac)ADVFPGNDS(ph)TASQDVANR_
PRKCB Phosphorylation S13 -1.038 0.335 _(ac)ADVFPGNDSTAS(ph)QDVANR_
PRKCB Phosphorylation S226 0.693 0.415 _STLNPQWNES(ph)FTFK_
PRKCB Ubiquitylation K315 0.213 0.518 _ISQGTK(gl)VPEEK_
PRKCD Ubiquitylation K138 -0.141 _SEDEAK(gl)FPTMNR_
PRKCD Ubiquitylation K222 0.185 0.658 _DTIFQK(gl)ER_
PRKCD Phosphorylation S302 -0.240 -0.222 _S(ph)DSASSEPVGIYQGFEK_
PRKCD Phosphorylation S304 0.378 0.289 _RSDS(ph)ASSEPVGIYQGFEK_
PRKCD Phosphorylation S506 -0.213 0.200 _AS(ph)TFCGTPDYIAPEILQGLK_
PRKCD Phosphorylation T507 -0.149 0.240 _AS(ph)TFCGTPDYIAPEILQGLK_
PRKCD Ubiquitylation K641 -2.000 _DYSNFDQEFLNEK(gl)AR_
PRKCD Phosphorylation S645 0.577 0.832 _ARLS(ph)YSDK_
PRKCD Phosphorylation S647 0.886 0.853 _ARLSYS(ph)DK_
PRKCH Ubiquitylation K36 -0.644 _K(gl)GHQLLDPYLTVSVDQVR_
PRKCH Ubiquitylation K152 1.064 _IFK(gl)HFTR_
PRKCH Phosphorylation S317 -0.562 -0.534 _TLAGMGLQPGNIS(ph)PTSK_
PRKCH Phosphorylation T656 -0.471 _SREDVSNFDPDFIKEEPVLT(ph)PIDEGHLPM(ox)INQDEFR_
PRKCI Ubiquitylation K244 0.289 _ESGK(gl)ASSSLGLQDFDLLR_
PRKCI Ubiquitylation K488 -0.090 0.847 _SLSVK(gl)AASVLK_
PRKCQ Phosphorylation S685 0.911 _ALINS(ph)MDQNMFR_
PRKCSH Ubiquitylation K383 1.564 0.883 _NK(gl)FEEAER_
PRKCZ Phosphorylation T560 -0.884 -1.578 _KQALPPFQPQITDDYGLDNFDTQFTSEPVQLT(ph)PDDEDAIKR_
PRKD1 Phosphorylation S207 0.941 1.048 _RLS(ph)NVSLTGVSTIR_
PRKD1 Phosphorylation T219 -0.068 -0.162 _T(ph)SSAELSTSAPDEPLLQK_
PRKD1 Phosphorylation S221 -0.662 -0.500 _TSS(ph)AELSTSAPDEPLLQK_
PRKD1 Phosphorylation S225 -0.970 -0.919 _TSSAELSTS(ph)APDEPLLSPVSPGFEQK_
PRKD1 Phosphorylation S236 -0.132 _TSSAELSTSAPDEPLLSPVS(ph)PGFEQK_
PRKD1 Phosphorylation S251 0.474 0.751 _SNS(ph)QSYIGRPIHLDK_
PRKD1 Phosphorylation S399 0.023 0.162 _TIS(ph)PSTSNNIPLMR_
PRKD1 Ubiquitylation K730 1.177 _IIGEK(gl)SFR_
PRKD1 Phosphorylation S744 -0.226 -0.287 _S(ph)VVGTPAYLAPEVLR_
PRKD2 Phosphorylation S197 0.239 0.895 _RLS(ph)STSLASGHSVR_
PRKD2 Phosphorylation T211 -0.119 _LGT(ph)SESLPCTAEELSR_
PRKD2 Phosphorylation S212 0.113 _LGTS(ph)ESLPCTAEELSR_
PRKD2 Phosphorylation S214 0.216 0.302 _LGTSES(ph)LPCTAEELSR_
PRKD2 Phosphorylation S710 -0.413 -0.511 _S(ph)VVGTPAYLAPEVLLNQGYNR_
PRKD2 Phosphorylation T714 -0.279 _S(ph)VVGTPAYLAPEVLLNQGYNR_
PRKD2 Ubiquitylation K730 1.177 _IIGEK(gl)SFR_
PRKD2 Phosphorylation S886 -0.718 -0.305 _DLGGACPPQDHDMQGLAERIS(ph)VL_
PRKD3 Phosphorylation S30 -1.576 _SVLPTAIPAVLPAAS(ph)PCS(ph)SPK_
PRKD3 Phosphorylation S31 -1.576 _SVLPTAIPAVLPAASPCS(ph)SPK_
PRKD3 Phosphorylation S364 -0.830 -0.918 _GLDDTEEPS(ph)PPEDK_
PRKD3 Phosphorylation S399 0.023 0.162 _TIS(ph)PSTSNNIPLMR_
PRKD3 Ubiquitylation K730 1.177 _IIGEK(gl)SFR_
PRKD3 Phosphorylation S744 -0.226 -0.287 _S(ph)VVGTPAYLAPEVLR_
PSEN1 Phosphorylation S313 0.844 _VSKNS(ph)KYNAESTER_
PSEN1 Ubiquitylation K314 0.016 0.414 _NSK(gl)YNAESTER_
PSEN1 Phosphorylation S366 -0.340 0.055 _AAVQELSS(ph)SILAGEDPEER_
PSEN1 Phosphorylation S367 0.005 0.066 _AAVQELSSS(ph)ILAGEDPEER_
PSEN2 Phosphorylation S58 -0.112 -0.130 _TSLM(ox)SAES(ph)PTPR_
RAC1 Ubiquitylation K115 -1.745 -0.215 _AK(gl)WYPEVR_
RAC1 Ubiquitylation K142 0.492 _LDLRDDK(gl)DTIEK_
RAC1 Ubiquitylation K152 0.099 -0.292 _K(gl)LTPITYPQGLAMAK_
RAC1 Ubiquitylation K166 -0.981 -0.655 _LTPITYPQGLAMAK(gl)EIGAVK_
RAC1 Ubiquitylation K172 1.026 0.412 _EIGAVK(gl)YLECSALTQR_
RAC1 Ubiquitylation K185 -0.113 0.578 _GLK(gl)TVFDEAIR_
RAC1 Ubiquitylation K202 -1.379 -1.447 _AVLCPPPVK(gl)KR_
RAC1 Ubiquitylation K203 -1.708 -1.447 _AVLCPPPVKK(gl)_
RAC3 Ubiquitylation K153 -0.133 _EIGSVK(gl)YLECSALTQR_
RAC3 Ubiquitylation K183 -1.447 _AVLCPPPVK(gl)K_
RAC3 Ubiquitylation K184 -1.812 -1.447 _AVLCPPPVKK(gl)_
RACGAP1 Ubiquitylation K53 0.960 _TDHELGK(gl)YK_
RACGAP1 Ubiquitylation K60 1.380 _DLLMK(gl)AETER_
RACGAP1 Ubiquitylation K71 0.352 0.233 _SALDVK(gl)LK_
RACGAP1 Ubiquitylation K84 0.484 0.846 _NQVDVEIK(gl)RR_
RACGAP1 Ubiquitylation K95 -0.492 _AEADCEK(gl)LER_
RACGAP1 Ubiquitylation K199 -2.285 -0.347 _QFVDGPPGPVK(gl)K_
RACGAP1 Ubiquitylation K200 -0.365 -0.347 _QFVDGPPGPVKK(gl)_
RACGAP1 Phosphorylation S203 1.255 0.831 _S(ph)IGSAVDQGNESIVAK_
RACGAP1 Ubiquitylation K292 -0.427 _LHDFVSK(gl)TVIKPESCVPCGK_
RACGAP1 Ubiquitylation K305 -0.770 _TVIKPESCVPCGK(gl)R_
RACGAP1 Phosphorylation T342 -1.072 -0.919 _DRCPLPCIPTLIGT(ph)PVK_
RACGAP1 Ubiquitylation K404 -0.200 _VK(gl)TVPLLSK_
RACGAP1 Ubiquitylation K490 0.528 _VAQSPHTK(gl)MDVANLAK_
RACGAP1 Phosphorylation T580 -0.839 _VSLLGPVTT(ph)PEHQLLK_
RACGAP1 Ubiquitylation K587 -0.985 _VSLLGPVTTPEHQLLK(gl)TPSSSSLSQR_
RACGAP1 Phosphorylation S590 -0.415 -0.021 _TPS(ph)SSSLSQR_
RACGAP1 Phosphorylation S591 -0.217 _TPSS(ph)SSLSQR_
RACGAP1 Ubiquitylation K604 0.953 _STLTK(gl)NTPR_
RAF1 Phosphorylation S29 0.028 -0.571 _DAVFDGSSCIS(ph)PTIVQQFGYQR_
RAF1 Phosphorylation T31 0.028 -0.669 _DAVFDGSSCIS(ph)PTIVQQFGYQR_
RAF1 Phosphorylation S244 0.053 _YSTPHAFTFNTSS(ph)PSSEGSLSQR_
RAF1 Phosphorylation S259 -0.069 0.054 _STS(ph)TPNVHM(ox)VSTTLPVDSR_
RAF1 Phosphorylation S301 -0.651 _SHSESASPSALSSSPNNLS(ph)PTGWSQPK_
RAF1 Phosphorylation T303 -0.664 _SHSESASPSALSSSPNNLSPT(ph)GWSQPK_
RAF1 Phosphorylation S497 -0.449 _SRWS(ph)GSQQVEQPTGSVLWMAPEVIR_
RAF1 Phosphorylation S621 0.212 0.271 _SAS(ph)EPSLHR_
RAF1 Phosphorylation S642 -0.197 0.463 _AAHTEDINACTLTTS(ph)PR_
RAPGEF2 Phosphorylation S1022 0.043 -0.570 _SETS(ph)PVAPR_
RAPGEF2 Phosphorylation S1080 -0.612 _DLPPFGINS(ph)PQALK_
RAPGEF5 Phosphorylation S84 -0.405 -0.905 _RIS(ph)NPYLEHTPSQIYGENSSCAGR_
RASA3 Ubiquitylation K641 0.708 _LEEESFK(gl)MK_
RASA3 Phosphorylation S809 0.646 0.589 _YGS(ph)QEHPIGDK_
RASGRP3 Phosphorylation S390 0.183 0.695 _SPTS(ph)PTTPNK_
RGS7 Phosphorylation S241 -1.071 -0.956 _SHS(ph)PTHTPTPETKPPTEDELQQQIK_
ROCK1 Phosphorylation S1105 -0.245 -0.845 _LLDLSDSTSVAS(ph)FPSADETDGNLPESR_
ROCK2 Ubiquitylation K1222 -0.679 _ADAK(gl)EIPR_
RPS6KA1 Phosphorylation S227 0.363 0.496 _AYS(ph)FCGTVEYM(ox)APEVVNR_
RPS6KA1 Phosphorylation T231 0.315 _KAYSFCGT(ph)VEYMAPEVVNR_
RPS6KA1 Ubiquitylation K316 -1.156 _LGSGPDGAEEIK(gl)R_
RPS6KA1 Phosphorylation T359 -0.149 -0.339 _T(ph)PKDSPGIPPSAGAHQLFR_
RPS6KA1 Phosphorylation S363 -0.711 -0.697 _TPKDS(ph)PGIPPSAGAHQLFR_
RPS6KA1 Ubiquitylation K566 -0.152 _ICDFGFAK(gl)QLR_
RPS6KA3 Phosphorylation S227 0.363 0.496 _AYS(ph)FCGTVEYM(ox)APEVVNR_
RPS6KA3 Phosphorylation T231 0.315 _KAYSFCGT(ph)VEYMAPEVVNR_
RPS6KA3 Ubiquitylation K322 -0.076 -0.376 _LGAGPDGVEEIK(gl)R_
RPS6KA3 Phosphorylation T365 -0.892 -1.003 _T(ph)PKDSPGIPPSANAHQLFR_
RPS6KA3 Phosphorylation S369 -0.621 -0.862 _TPKDS(ph)PGIPPSANAHQLFR_
RPS6KA3 Ubiquitylation K566 -0.152 _ICDFGFAK(gl)QLR_
RPS6KA3 Phosphorylation S715 -0.923 -0.880 _NQS(ph)PVLEPVGR_
RPS6KA6 Phosphorylation S227 0.363 0.496 _AYS(ph)FCGTVEYM(ox)APEVVNR_
RPS6KA6 Phosphorylation T231 0.315 _KAYSFCGT(ph)VEYMAPEVVNR_
RPS6KA6 Ubiquitylation K566 -0.152 _ICDFGFAK(gl)QLR_
SDCBP Phosphorylation S6 0.120 0.427 _(ac)SLYPS(ph)LEDLKVDK_
SDCBP Ubiquitylation K35 -0.806 _(ac)SLYPSLEDLKVDK(gl)_
SDCBP Ubiquitylation K129 0.064 0.792 _RAEIK(gl)QGIR_
SDCBP Ubiquitylation K199 -0.134 -0.436 _VLK(gl)QAFGEK_
SDCBP Ubiquitylation K243 0.141 _ITSIVK(gl)DSSAAR_
SH2B1 Phosphorylation S96 0.112 -0.143 _ASGSLSPPILAPLS(ph)PGAEISPHDLSLESCR_
SH2B1 Phosphorylation S125 0.018 0.257 _S(ph)SEDLAGPLPSSVSSSSTTSSKPK_
SH2B1 Phosphorylation S126 0.018 0.257 _S(ph)SEDLAGPLPSSVSSSSTTSSKPK_
SH3BP5 Ubiquitylation K6 -0.925 _(ac)MDAALK(gl)R_
SH3BP5 Ubiquitylation K90 -1.258 _LDELVKK(gl)_
SH3BP5 Ubiquitylation K173 -0.619 _VMEAEQTK(gl)TR_
SH3BP5 Ubiquitylation K181 -1.200 _SELVHK(gl)ETAAR_
SH3BP5 Ubiquitylation K240 -0.180 _LTLAK(gl)GEYK_
SIK1 Phosphorylation S435 -0.305 _PVS(ph)PSSLLDTAISEEAR_
SMAD2 Phosphorylation T8 -0.896 -0.885 _(ac)SSILPFT(ph)PPVVK_
SMAD2 Ubiquitylation K13 -0.058 _(ac)SSILPFTPPVVK(gl)R_
SQSTM1 Ubiquitylation K13 0.150 0.302 _AYLLGK(gl)EDAAR_
SQSTM1 Phosphorylation S28 -0.721 _RFSFCCS(ph)PEPEAEAEAAAGPGPCER_
SQSTM1 Ubiquitylation K141 -0.915 _YK(gl)CSVCPDYDLCSVCEGK_
SQSTM1 Ubiquitylation K157 -0.852 -0.677 _CSVCPDYDLCSVCEGK(gl)GLHR_
SQSTM1 Phosphorylation T269 -0.681 -0.421 _LT(ph)PVS(ph)PESSSTEEK_
SQSTM1 Phosphorylation S272 0.171 0.044 _LTPVS(ph)PESSSTEEK_
SQSTM1 Phosphorylation S332 -0.007 _IALESEGRPEEQMESDNCS(ph)GGDDDWTHLSSK_
SQSTM1 Ubiquitylation K420 -1.122 -0.061 _LLQTK(gl)NYDIGAALDTIQYSK_
SQSTM1 Ubiquitylation K435 -1.352 -0.780 _NYDIGAALDTIQYSK(gl)HPPPL_
SRC Phosphorylation S17 -0.604 -0.689 _S(ph)LEPAENVHGAGGGAFPASQTPSKPASADGHR_
SRC Phosphorylation S75 0.060 0.331 _LFGGFNSSDTVTS(ph)PQR_
SRPK1 Phosphorylation S67 -1.128 -1.153 _GSAPHSESDLPEQEEEILGS(ph)DDDEQEDPNDYCK_
SRPK1 Ubiquitylation K579 0.354 _K(gl)LIVAGK_
SRPK1 Ubiquitylation K585 0.939 _KLIVAGK(gl)YSK_
SRPK2 Phosphorylation S483 -1.638 _IPESQFPEFSTSLFSGSLEPVACGSVLSEGSPLTEQEES(ph)SPSHDR_
SRPK2 Phosphorylation S496 0.096 _TVSAS(ph)STGDLPK_
SRPK2 Phosphorylation S497 -0.015 -0.154 _TVSASS(ph)TGDLPK_
SRPK2 Ubiquitylation K618 0.453 _HFALSGK(gl)YSR_
STK17A Ubiquitylation K43 -0.699 _GK(gl)FAVVR_
STK17B Ubiquitylation K43 -0.699 _GK(gl)FAVVR_
STK17B Ubiquitylation K53 -1.448 _QCISK(gl)STGQEYAAK_
STK3 Ubiquitylation K176 -0.350 _DIK(gl)AGNILLNTEGHAK_
STK3 Ubiquitylation K205 -0.223 -0.386 _LADFGVAGQLTDTMAK(gl)R_
STK3 Phosphorylation S344 0.416 0.115 _ELEEEEENS(ph)DEDELDSHTM(ox)VK_
STK3 Phosphorylation S344 0.573 0.366 _EMDQDDEENS(ph)EEDEMDSGTMVR_
STK3 Phosphorylation S413 0.603 1.205 _NATS(ph)PQVQRPSFMDYFDK_
STK3 Ubiquitylation K481 -0.782 _LK(gl)ALDPMMER_
STK4 Ubiquitylation K176 -0.350 _DIK(gl)AGNILLNTEGHAK_
STK4 Ubiquitylation K205 -0.223 -0.386 _LADFGVAGQLTDTMAK(gl)R_
STK4 Phosphorylation S320 0.555 0.552 _EVDQDDEENS(ph)EEDEMDSGTM(ox)VR_
STK4 Phosphorylation S344 0.573 0.366 _EMDQDDEENS(ph)EEDEMDSGTMVR_
STMN1 Ubiquitylation K9 0.554 0.911 _(ac)ASSDIQVK(gl)ELEK_
STMN1 Phosphorylation S16 0.888 0.583 _RAS(ph)GQAFELILS(ph)PR_
STMN1 Phosphorylation S25 1.127 1.146 _RAS(ph)GQAFELILS(ph)PR_
STMN1 Ubiquitylation K29 -1.344 _SK(gl)ESVPEFPLSPPK_
STMN1 Phosphorylation S31 0.601 0.547 _ES(ph)VPEFPLSPPKKK_
STMN1 Phosphorylation S38 0.095 0.145 _SKESVPEFPLS(ph)PPKK_
STMN1 Phosphorylation S46 1.229 1.195 _KKDLS(ph)LEEIQK_
STMN1 Ubiquitylation K52 -0.553 0.474 _DLSLEEIQK(gl)K_
STMN1 Ubiquitylation K53 0.144 _DLSLEEIQKK(gl)_
STMN1 Phosphorylation S63 -0.108 0.319 _S(ph)HEAEVLK_
STMN1 Ubiquitylation K100 1.035 _MAEEK(gl)LTHK_
STMN1 Ubiquitylation K119 0.525 0.741 _EAQMAAK(gl)LER_
STMN1 Ubiquitylation K128 0.850 _DK(gl)HIEEVRK_
TLK1 Phosphorylation S741 0.299 _RS(ph)NSSGNLHMAGLTASPTPPSSSIITY_
TLK2 Phosphorylation T98 0.262 _ISDYFEFAGGSAPGT(ph)SPGR_
TLK2 Phosphorylation S99 0.267 -0.122 _ISDYFEFAGGSAPGTS(ph)PGR_
TNIK Phosphorylation S680 0.363 0.497 _TTSIS(ph)PALAR_
TNIK Phosphorylation S707 0.024 -0.032 _LGSQPIRAS(ph)NPDLR_
TNIK Phosphorylation S764 0.214 -0.395 _ANS(ph)KS(ph)EGSPVLPHEPAK_
TNIK Phosphorylation S766 -0.772 -0.395 _S(ph)EGSPVLPHEPAK_
TNIK Phosphorylation S769 -0.527 -0.660 _SEGS(ph)PVLPHEPAK_
TNIK Ubiquitylation K824 -0.222 _IEETNRPMK(gl)K_
TNIK Phosphorylation S954 1.646 _VSTHS(ph)QEMDSGTEYGMGSSTK_
TNS3 Phosphorylation S776 1.240 -0.070 _LS(ph)LGQYDNDAGGQLPFSK_
TOLLIP Ubiquitylation K94 -0.411 0.859 _LNITVVQAK(gl)_
TOLLIP Ubiquitylation K97 0.276 _LAK(gl)NYGMTR_
TOLLIP Ubiquitylation K177 0.510 _QGK(gl)VEDKWYSLSGR_
TRAF3IP2 Phosphorylation T402 0.746 _T(ph)SNLPEELR_
UNC13C Ubiquitylation K1496 1.018 0.188 _IDLSK(gl)YR_
WNK1 Phosphorylation S2476 -0.727 -0.899 _KEGPVAS(ph)PPFMDLEQAVLPAVIPK_
WNK1 Phosphorylation S2503 -0.810 -0.764 _KEKPELSEPS(ph)HLNGPSSDPEAAFLSR_
WNK1 Phosphorylation S2509 -0.298 _KEKPELSEPSHLNGPS(ph)SDPEAAFLSR_
WNK1 Phosphorylation S2510 -0.532 -0.298 _KEKPELSEPSHLNGPSS(ph)DPEAAFLSR_
WNK1 Phosphorylation S2527 -0.349 _DVDDGSGS(ph)PHSPHQLSSK_
WNK1 Phosphorylation S2530 0.202 -0.225 _DVDDGSGSPHS(ph)PHQLSSK_
WNK2 Phosphorylation S1776 -1.152 _KRPEQQDVS(ph)SPAK_
WNK2 Phosphorylation S1777 -0.593 _KRPEQQDVSS(ph)PAK_
WNK2 Phosphorylation S2476 -0.727 -0.899 _KEGPVAS(ph)PPFMDLEQAVLPAVIPK_
WNK2 Phosphorylation S2503 -0.810 -0.764 _KEKPELSEPS(ph)HLNGPSSDPEAAFLSR_
WNK2 Phosphorylation S2509 -0.298 _KEKPELSEPSHLNGPS(ph)SDPEAAFLSR_
WNK2 Phosphorylation S2510 -0.532 -0.298 _KEKPELSEPSHLNGPSS(ph)DPEAAFLSR_
WNK2 Phosphorylation S2527 -0.349 _DVDDGSGS(ph)PHSPHQLSSK_
WNK2 Phosphorylation S2530 0.202 -0.225 _DVDDGSGSPHS(ph)PHQLSSK_
WNK3 Phosphorylation S2476 -0.727 -0.899 _KEGPVAS(ph)PPFMDLEQAVLPAVIPK_
WNK3 Phosphorylation S2503 -0.810 -0.764 _KEKPELSEPS(ph)HLNGPSSDPEAAFLSR_
WNK3 Phosphorylation S2509 -0.298 _KEKPELSEPSHLNGPS(ph)SDPEAAFLSR_
WNK3 Phosphorylation S2510 -0.532 -0.298 _KEKPELSEPSHLNGPSS(ph)DPEAAFLSR_
WNK3 Phosphorylation S2527 -0.349 _DVDDGSGS(ph)PHSPHQLSSK_
WNK3 Phosphorylation S2530 0.202 -0.225 _DVDDGSGSPHS(ph)PHQLSSK_
WSB1 Ubiquitylation K31 -0.295 _TIGELLAPAAPFDK(gl)K_
WSB1 Ubiquitylation K32 -1.106 -0.295 _TIGELLAPAAPFDKK(gl)_
YWHAE Ubiquitylation K38 0.710 1.822 _YDEMVESMK(gl)K_
YWHAE Ubiquitylation K39 1.734 _YDEMVESMKK(gl)_
YWHAE Ubiquitylation K60 0.554 1.732 _NLLSVAYK(gl)NVIGAR_
YWHAE Ubiquitylation K83 0.375 0.643 _IISSIEQKEENK(gl)GGEDKLK_
YWHAE Ubiquitylation K90 1.103 _GGEDKLK(gl)MIR_
YWHAE Ubiquitylation K116 -0.289 _LICCDILDVLDK(gl)HLIPAANTGESK_
YWHAE Ubiquitylation K133 0.653 1.264 _VFYYK(gl)M(ox)K_
YWHAE Ubiquitylation K152 0.031 0.601 _K(gl)EAAENSLVAYK_
YWHAE Phosphorylation S210 0.534 0.506 _AAFDDAIAELDTLS(ph)EESYK_
YWHAE Phosphorylation S213 0.541 _AAFDDAIAELDTLSEES(ph)YK_


.

© Copyright Svejstrup Laboratory 2015