bioLOGIC Data » bioLOGIC CategoryView » bioLOGIC VennView » Experimental Details »
bioLOGIC Category

Results for the Category
SH3_2
(IPR011511)

RNAi screen result RNAPII IP (MG132) CSB IP CSB IP (MG132) Chrom. Chrom. (MG132) Ubi /Phospo Ubi /Phospho (MG132)
W

Protein Results:

Results for post-translational modifications (below)
Gene name MGoogle Score RNAi high RNAi low RNAPII-IP (MG132) CSB-IP CSB-IP (MG132) Chrom. Chrom. (MG132)
DLG3 2 0.180 -1.120 1.552 0.102 0.488
DLG3 2 0.180 -1.120
TJP1 2 -0.410 1.150
TJP1 2 -0.410 1.150 -0.039 -0.011
TJP1 2 -0.410 1.150
FYN 1 1.080 -1.100
FYN 1 1.080 -1.100
DLG1 1 0.400 -0.220 1.552 0.102 0.488
PPP1R13B 1 0.760 -0.700 -0.399 -0.481
PPP1R13B 1 0.760 -0.700
PLCG1 1 -0.170 0.000
MCF2L 1 2.560 -1.220
DLG4 1 -0.020 0.320 1.552 0.102 0.488
SH3GL3 1 -1.870 3.600
SH3GL1 1 0.960 -1.010
TP53BP2 1 1.060 -0.800 -0.399 -0.481
CASK 1 2.050 -1.110
CASK 1 2.050 -1.110 -0.162 -0.217 -0.918 0.048 0.372
DLG2 1 -0.710 1.560 1.552 0.102 0.488
DLG2 1 1.570 -1.220 1.552 0.102 0.488
SH3RF1 1 2.280 -0.420
PACSIN3 1 0.140 0.230 1.239 0.925
SH3RF3 1 2.780 -1.280
SPTAN1 1 1.040 -0.790
SPTAN1 1 1.040 -0.790 -0.323 -0.738 0.512 0.509
LYN 1 -1.790 3.770
LYN 1 -1.790 3.770
LASP1 0 0.860 0.020 -0.031 0.195
LASP1 0 0.860 0.020
SKAP2 0 -0.330 0.880
BAIAP2L1 0 0.290 -0.240
ZDHHC6 0
ARHGEF5 0 -1.480 2.200
ARHGEF5 0 1.110 -0.980
NCK2 0 -0.870 1.530
ARHGAP10 0 0.320 -0.130
MPP5 0 -0.550 1.720 0.158 0.229 -0.737
CTTN 0 0.900 0.000 0.303 0.658 -0.157
SORBS1 0 0.660 -0.330
ABL1 0 0.670 -0.070
SH3GLB1 0 -0.270 0.970
CRKL 0 0.290 -0.620
PACSIN2 0 0.657 -0.118 -3.051
SGSM3 0 0.600 -0.480
PTK6 0 -0.300 0.700 0.520 0.139 1.329 0.365 0.320
ARHGEF7 0 -0.410 -0.070
CSK 0 1.200 -0.960 -1.211
CSK 0 1.200 -0.960
MPP6 0 0.130 0.100 1.137 0.965 0.797
SH3GL2 0 0.310 -0.450
SH3PXD2A 0 1.170 -0.770
MPP2 0 0.810 -0.250
MPP2 0 0.810 -0.250 0.384 1.226
SASH1 0 0.250 -0.680
ARHGEF26 0 1.220 -0.810
STAM2 0 -0.510 0.650
TJP2 0 0.160 0.070 -1.237 -1.460
TJP2 0 0.160 0.070 0.144 0.035 0.024
SORBS3 0
SORBS3 0
DOCK4 0 -0.420 0.110
ARHGEF6 0 0.570 -0.210
ARHGEF6 0 0.570 -0.210
SH3BP4 0 -0.080 0.600
SNX9 0 0.301 1.109 0.556 0.141 0.127
ARHGAP32 0 0.480 -0.120
OSTF1 0 1.260 -0.960 0.744
DBNL 0 0.940 -0.940 0.425
DBNL 0 1.040 -0.600 0.425
DBNL 0 0.940 -0.940 0.111 0.457 0.226
DBNL 0 1.040 -0.600 0.111 0.457 0.226
ABI1 0 0.853 0.389
FNBP1L 0 0.890 -0.940
ABI2 0 -0.850 0.640
ABL2 0 0.050 -0.340
PIK3R1 0 1.910 -1.220 -0.441 0.147
SH3KBP1 0 -0.400 -0.020 -0.522
DOCK5 0 0.550 -0.090
SH3GLB2 0 -0.470 0.450
MPP7 0 0.640 -0.320 1.118 0.576
EPS8 0 -0.740 0.680
EPS8 0 -0.740 0.680 1.272
MIA3 0 -0.480 0.870
MIA3 0 -0.480 0.870 0.112 0.137
NCK1 0 -0.370 0.580
RUSC1 0 0.280 -0.220
CRK 0 -0.790 0.230
CASKIN1 0 -0.190 0.560
SH3PXD2B 0 0.340 -0.580
YES1 0 0.340 -0.470 0.295 0.576
CASKIN2 0 -0.500 0.210
GRB2 0 -0.240 0.300 -1.021 0.057 0.906
SNX18 0 1.820 -0.780 -2.601
LCK 0 -0.490 1.390 0.295 0.576
FNBP1 0 0.860 -0.550
SRC 0 0.050 0.470 -0.031
CD2AP 0 -0.900 -0.330 1.125 -0.237 -0.281 -1.465 -1.354
ITSN2 0 -0.710 0.950 0.287 0.672
ITSN1 0 -0.670 0.610
ITSN1 0 -0.670 0.610 0.287 0.672
NCKIPSD 0 0.410 -0.480 -0.666 0.444
NCKIPSD 0 0.880 -0.700 -0.666 0.444

PTM Sites:

Back to Protein Results
Gene name PTM type PTM site UV UV (MG132) Sequence
ABI1 Phosphorylation T179 -1.186 _TNPPT(ph)QKPPSPPMSGR_
ABI1 Phosphorylation S184 -1.237 -1.395 _TNPPTQKPPS(ph)PPMSGR_
ABI1 Phosphorylation T230 0.423 0.203 _T(ph)ASLNQRPR_
ABI1 Phosphorylation S232 0.057 0.186 _TAS(ph)LNQRPR_
ABI1 Phosphorylation S324 1.188 _HNS(ph)TTSSTSSGGYRR_
ABI2 Ubiquitylation K167 -0.458 _VSTQNMK(gl)MGGLPR_
ABI2 Phosphorylation S183 -0.737 -0.939 _TTPPTQKPPS(ph)PPMSGK_
ABI2 Phosphorylation S227 -0.636 -0.480 _NMAPSQQS(ph)PVR_
ABL1 Phosphorylation S1083 -1.131 -0.857 _GQGESDPLDHEPAVS(ph)PLLPR_
ABL1 Phosphorylation S1134 0.293 _SSS(ph)FREMDGQPER_
ABL1 Phosphorylation S1232 0.821 0.183 _SCS(ph)ASCVPHGAK_
ABL2 Phosphorylation S618 -0.733 _GAQASS(ph)GSPALPR_
ABL2 Phosphorylation S620 0.568 0.091 _GAQASSGS(ph)PALPR_
ABL2 Phosphorylation S631 0.529 0.416 _DKS(ph)PSSLLEDAK_
ABL2 Phosphorylation S634 0.322 _DKSPSS(ph)LLEDAK_
ABL2 Phosphorylation S781 0.421 _S(ph)NSTSSM(ox)SSGLPEQDR_
ABL2 Phosphorylation S783 -0.171 _SNS(ph)TSSMSSGLPEQDR_
ABL2 Phosphorylation S817 0.028 0.055 _TVS(ph)TSSQPEENVDR_
ABL2 Phosphorylation S936 -0.218 -0.547 _VPVLIS(ph)PTLK_
ARHGAP10 Phosphorylation S591 -0.697 -1.450 _TPPDTTFPEPTCLSAS(ph)PPNAPPR_
ARHGAP32 Phosphorylation S703 0.067 _S(ph)AKSEESLTSLHAVDGDSK_
ARHGAP32 Phosphorylation S706 0.359 0.358 _SAKS(ph)EESLTSLHAVDGDSK_
ARHGAP32 Phosphorylation S871 0.466 0.562 _LSPFFTLDLS(ph)PTEDK_
ARHGEF26 Phosphorylation S22 -0.182 0.344 _S(ph)IPQPHQLLGR_
ARHGEF26 Phosphorylation S80 0.394 _TVHRS(ph)PLLLGAQR_
ARHGEF26 Phosphorylation S222 -0.695 -0.516 _LPS(ph)QENELLENPSVVLSTNSPAALK_
ARHGEF26 Phosphorylation S392 -0.284 0.085 _ALDIDS(ph)DEESEPK_
ARHGEF5 Phosphorylation S11 -0.663 -0.620 _GAS(ph)PPISAIEEFSIIPEAPM(ox)R_
ARHGEF5 Phosphorylation S445 -1.196 _AEELS(ph)PAALSPSLEPIR_
ARHGEF5 Phosphorylation S662 -1.059 0.313 _DYSTVSAS(ph)PTALSTLK_
ARHGEF5 Phosphorylation T1121 -0.492 _LESLSET(ph)PGPSSPR_
ARHGEF5 Phosphorylation S1125 -0.288 -0.574 _LESLSETPGPS(ph)SPR_
ARHGEF5 Phosphorylation S1126 -0.717 _LESLSETPGPSS(ph)PR_
ARHGEF6 Phosphorylation S225 -0.163 -0.076 _SSERPLS(ph)PK_
ARHGEF6 Phosphorylation S415 0.662 0.947 _M(ox)S(ph)GFIYQGK_
ARHGEF6 Phosphorylation S600 0.797 _S(ph)TAALEEDAQILK_
ARHGEF6 Phosphorylation T601 0.797 _S(ph)TAALEEDAQILK_
ARHGEF6 Phosphorylation S684 0.068 -0.061 _KDS(ph)IPQVLLPEEEKLIIEETR_
ARHGEF7 Phosphorylation S50 1.374 1.424 _IKS(ph)FDSLGSQSLHTR_
ARHGEF7 Phosphorylation S154 -0.198 0.140 _SGTLKS(ph)PPK_
ARHGEF7 Phosphorylation S415 0.662 0.947 _M(ox)S(ph)GFIYQGK_
ARHGEF7 Phosphorylation S600 0.797 _S(ph)TAALEEDAQILK_
ARHGEF7 Phosphorylation T601 0.797 _S(ph)TAALEEDAQILK_
ARHGEF7 Phosphorylation S635 0.061 -0.203 _KES(ph)APQVLLPEEEKIIVEETK_
BAIAP2L1 Ubiquitylation K234 0.469 -0.323 _WQETCVDAIK(gl)VPEK_
BAIAP2L1 Phosphorylation S255 -0.955 _TPASTPVS(ph)GTPQASPMIER_
BAIAP2L1 Phosphorylation T257 -0.751 -0.230 _TPASTPVSGT(ph)PQAS(ph)PM(ox)IER_
BAIAP2L1 Phosphorylation S261 -0.495 -0.543 _TPASTPVSGT(ph)PQAS(ph)PMIER_
BAIAP2L1 Ubiquitylation K279 1.104 _DYDTLSK(gl)CSPK_
BAIAP2L1 Phosphorylation S295 0.238 _AYTS(ph)PLIDMFNNPATAAPNSQR_
BAIAP2L1 Phosphorylation T412 -1.141 -1.078 _LLEENETEAVTVPT(ph)PSPTPVR_
BAIAP2L1 Phosphorylation S414 -1.211 -1.166 _LLEENETEAVTVPTPS(ph)PTPVR_
CASK Ubiquitylation K41 1.029 1.231 _ETGQQFAVK(gl)IVDVAK_
CASK Ubiquitylation K60 0.240 0.541 _FTSSPGLSTEDLK(gl)R_
CASK Phosphorylation S570 0.125 _TQSS(ph)SCEDLPSTTQPK_
CASK Phosphorylation S571 0.134 -0.032 _TQSSS(ph)CEDLPSTTQPK_
CASK Ubiquitylation K665 -0.631 _LENSK(gl)NGTAGLIPSPELQEWR_
CASK Ubiquitylation K691 1.108 _TK(gl)QEQQASCTWFGK_
CASK Ubiquitylation K703 0.627 _TKQEQQASCTWFGK(gl)K_
CASK Ubiquitylation K704 0.627 _TKQEQQASCTWFGK(gl)K_
CASKIN1 Phosphorylation S787 -1.078 _TRPGS(ph)PQALGGPHGPAPATAK_
CASKIN1 Phosphorylation S1257 -0.553 -0.891 _KVPLPGPGS(ph)PEVK_
CASKIN2 Phosphorylation S403 0.256 0.075 _VGLSPDSPAGDRNS(ph)VGSEGSVGSIR_
CD2AP Ubiquitylation K71 -0.241 0.187 _ETEFKDDSLPIK(gl)R_
CD2AP Ubiquitylation K226 0.603 _EGSVK(gl)LR_
CD2AP Phosphorylation S510 0.349 0.536 _FNGGHS(ph)PTHSPEK_
CD2AP Phosphorylation T512 0.845 _FNGGHS(ph)PTHSPEK_
CRK Phosphorylation S40 0.533 0.363 _DS(ph)STSPGDYVLSVSENSR_
CRK Phosphorylation S41 1.065 0.801 _DSS(ph)TSPGDYVLSVSENSR_
CRKL Phosphorylation S41 0.868 _DS(ph)STCPGDYVLSVSENSR_
CRKL Phosphorylation S107 -0.818 -1.177 _YPS(ph)PPMGSVSAPNLPTAEDNLEYVR_
CSK Ubiquitylation K196 -0.133 _SGWALNMKELK(gl)_
CTTN Ubiquitylation K110 0.305 _LSK(gl)HCSQVDSVR_
CTTN Phosphorylation S150 0.128 0.953 _HAS(ph)QKDYSSGFGGK_
CTTN Ubiquitylation K152 0.237 _HASQK(gl)DYSSGFGGK_
CTTN Ubiquitylation K193 0.574 _DYSK(gl)GFGGK_
CTTN Phosphorylation T399 -0.214 -1.441 _AKT(ph)QTPPVS(ph)PAPQPTEER_
CTTN Phosphorylation T401 -1.594 -1.336 _TQT(ph)PPVSPAPQPTEER_
CTTN Phosphorylation S405 -0.318 -0.627 _TQT(ph)PPVS(ph)PAPQPTEER_
CTTN Phosphorylation T411 -1.196 -1.112 _TQT(ph)PPVSPAPQPT(ph)EERLPSSPVYEDAASFK_
CTTN Phosphorylation S417 1.028 -0.653 _TQT(ph)PPVS(ph)PAPQPTEERLPS(ph)SPVYEDAASFK_
CTTN Phosphorylation S418 0.897 0.444 _LPSS(ph)PVYEDAASFK_
CTTN Phosphorylation Y421 -1.514 _T(ph)QTPPVSPAPQPTEERLPSSPVY(ph)EDAASFK_
CTTN Phosphorylation S447 -1.103 0.639 _GPVSGTEPEPVYS(ph)MEAADYR_
DBNL Ubiquitylation K144 0.756 _ASGANYSFHK(gl)ESGR_
DBNL Ubiquitylation K164 -0.807 0.448 _FQDVGPQAPVGSVYQK(gl)TNAVSEIKR_
DBNL Ubiquitylation K172 -0.071 _TNAVSEIK(gl)R_
DBNL Phosphorylation S232 -0.858 _YQEQGGEAS(ph)PQR_
DBNL Phosphorylation S269 -0.006 -0.553 _AM(ox)S(ph)TTSISSPQPGK_
DBNL Phosphorylation S272 -0.752 -0.377 _AMS(ph)TTS(ph)ISSPQPGK_
DBNL Phosphorylation S274 -0.547 -0.544 _AM(ox)STTSIS(ph)SPQPGK_
DBNL Phosphorylation S275 -0.547 0.433 _AMSTTSISS(ph)PQPGK_
DBNL Ubiquitylation K280 0.113 _AMSTTSISSPQPGK(gl)LR_
DBNL Phosphorylation S283 -0.388 0.222 _LRS(ph)PFLQK_
DBNL Phosphorylation T291 0.823 -0.150 _QLT(ph)QPETHFGR_
DLG1 Phosphorylation S102 -1.455 _SKPSEPIQPVNTWEISSLPSSTVTSETLPSSLS(ph)PSVEK_
DLG1 Phosphorylation T115 -0.707 -1.378 _YQDEDT(ph)PPQEHISPQITNEVIGPELVHVSEK_
DLG1 Phosphorylation S122 -1.073 _YQDEDTPPQEHIS(ph)PQITNEVIGPELVHVSEK_
DLG1 Phosphorylation S158 0.773 _NLSEIENVHGFVSHSHIS(ph)PIK_
DLG1 Ubiquitylation K321 1.264 1.435 _IMEIK(gl)LIK_
DLG1 Ubiquitylation K361 0.180 _IIEGGAAHK(gl)DGK_
DLG1 Ubiquitylation K452 -0.704 _YSPVSK(gl)AVLGDDEITREPR_
DLG1 Ubiquitylation K556 0.105 _FEAK(gl)IHDLR_
DLG1 Phosphorylation S573 0.697 _EQM(ox)M(ox)NSSISSGS(ph)GSLR_
DLG1 Phosphorylation S575 0.255 0.729 _EQMMNSSISSGSGS(ph)LR_
DLG1 Ubiquitylation K843 1.259 _SMENIMEMNK(gl)R_
DLG2 Phosphorylation S102 -1.455 _SKPSEPIQPVNTWEISSLPSSTVTSETLPSSLS(ph)PSVEK_
DLG2 Phosphorylation T115 -0.707 -1.378 _YQDEDT(ph)PPQEHISPQITNEVIGPELVHVSEK_
DLG2 Phosphorylation S122 -1.073 _YQDEDTPPQEHIS(ph)PQITNEVIGPELVHVSEK_
DLG2 Phosphorylation S158 0.773 _NLSEIENVHGFVSHSHIS(ph)PIK_
DLG2 Ubiquitylation K321 1.264 1.435 _IMEIK(gl)LIK_
DLG2 Ubiquitylation K361 0.180 _IIEGGAAHK(gl)DGK_
DLG2 Ubiquitylation K452 -0.704 _YSPVSK(gl)AVLGDDEITREPR_
DLG2 Ubiquitylation K556 0.105 _FEAK(gl)IHDLR_
DLG2 Phosphorylation S573 0.697 _EQM(ox)M(ox)NSSISSGS(ph)GSLR_
DLG2 Phosphorylation S575 0.255 0.729 _EQMMNSSISSGSGS(ph)LR_
DLG2 Ubiquitylation K843 1.259 _SMENIMEMNK(gl)R_
DLG3 Phosphorylation S102 -1.455 _SKPSEPIQPVNTWEISSLPSSTVTSETLPSSLS(ph)PSVEK_
DLG3 Phosphorylation T115 -0.707 -1.378 _YQDEDT(ph)PPQEHISPQITNEVIGPELVHVSEK_
DLG3 Phosphorylation S122 -1.073 _YQDEDTPPQEHIS(ph)PQITNEVIGPELVHVSEK_
DLG3 Phosphorylation S158 0.773 _NLSEIENVHGFVSHSHIS(ph)PIK_
DLG3 Ubiquitylation K321 1.264 1.435 _IMEIK(gl)LIK_
DLG3 Ubiquitylation K361 0.180 _IIEGGAAHK(gl)DGK_
DLG3 Ubiquitylation K368 1.043 1.755 _IIEGGAAQK(gl)DGR_
DLG3 Ubiquitylation K452 -0.704 _YSPVSK(gl)AVLGDDEITREPR_
DLG3 Ubiquitylation K556 0.105 _FEAK(gl)IHDLR_
DLG3 Phosphorylation S573 0.697 _EQM(ox)M(ox)NSSISSGS(ph)GSLR_
DLG3 Phosphorylation S575 0.255 0.729 _EQMMNSSISSGSGS(ph)LR_
DLG3 Ubiquitylation K843 1.259 _SMENIMEMNK(gl)R_
DLG4 Phosphorylation S102 -1.455 _SKPSEPIQPVNTWEISSLPSSTVTSETLPSSLS(ph)PSVEK_
DLG4 Phosphorylation T115 -0.707 -1.378 _YQDEDT(ph)PPQEHISPQITNEVIGPELVHVSEK_
DLG4 Phosphorylation S122 -1.073 _YQDEDTPPQEHIS(ph)PQITNEVIGPELVHVSEK_
DLG4 Phosphorylation S158 0.773 _NLSEIENVHGFVSHSHIS(ph)PIK_
DLG4 Ubiquitylation K321 1.264 1.435 _IMEIK(gl)LIK_
DLG4 Ubiquitylation K361 0.180 _IIEGGAAHK(gl)DGK_
DLG4 Ubiquitylation K452 -0.704 _YSPVSK(gl)AVLGDDEITREPR_
DLG4 Ubiquitylation K556 0.105 _FEAK(gl)IHDLR_
DLG4 Phosphorylation S573 0.697 _EQM(ox)M(ox)NSSISSGS(ph)GSLR_
DLG4 Phosphorylation S575 0.255 0.729 _EQMMNSSISSGSGS(ph)LR_
DLG4 Ubiquitylation K843 1.259 _SMENIMEMNK(gl)R_
DOCK4 Phosphorylation S1665 -0.102 _NSAPASVS(ph)PDGTR_
DOCK4 Phosphorylation T1669 0.625 _NSAPASVS(ph)PDGTR_
DOCK4 Phosphorylation S1745 -0.498 _AS(ph)PLLSDK_
DOCK4 Phosphorylation T1850 0.758 _HTT(ph)SVSPSPAGR_
DOCK4 Phosphorylation S1853 0.304 _HTTSVS(ph)PSPAGR_
DOCK5 Phosphorylation S1834 0.783 _NS(ph)TELAPPLPVR_
EPS8 Phosphorylation S625 -2.045 _PADTPPAPS(ph)PPPTPAPVPVPLPPSTPAPVPVSK_
FNBP1 Phosphorylation S296 0.887 1.145 _TVS(ph)DNSLSNSR_
FNBP1L Phosphorylation S295 0.730 0.489 _TIS(ph)DGTISASK_
FNBP1L Phosphorylation T496 -0.149 _HSSDINHLVT(ph)QGRESPEGSYTDDANQEVR_
FNBP1L Phosphorylation S501 -0.322 -0.235 _ES(ph)PEGSYTDDANQEVR_
FYN Ubiquitylation K13 0.286 _DKEATK(gl)LTEER_
FYN Phosphorylation S21 0.373 0.731 _DGS(ph)LNQSSGYR_
FYN Ubiquitylation K259 0.921 _LTDLSVK(gl)TK_
FYN Ubiquitylation K261 0.099 _LTDLSVKTK(gl)_
FYN Ubiquitylation K273 6.025 _SLCLEKK(gl)_
FYN Ubiquitylation K275 -0.521 _ESLQLIK(gl)R_
GRB2 Ubiquitylation K10 0.146 _YDFK(gl)ATADDELSFK_
GRB2 Ubiquitylation K20 -0.078 _ATADDELSFK(gl)R_
GRB2 Ubiquitylation K69 -0.362 0.641 _AK(gl)AEEMLSK_
GRB2 Ubiquitylation K76 0.754 _AEEMLSK(gl)QR_
GRB2 Ubiquitylation K109 0.381 -0.002 _FGNDVQHFK(gl)VLR_
ITSN1 Phosphorylation S203 -0.497 -0.811 _AQS(ph)FDVASVPPVAEWAVPQSSR_
ITSN1 Phosphorylation S313 0.882 0.188 _S(ph)GSGISVISSTSVDQR_
ITSN1 Phosphorylation S315 0.675 0.750 _SGS(ph)GISVISSTSVDQR_
ITSN1 Ubiquitylation K569 0.570 _DSLVTLK(gl)R_
ITSN1 Ubiquitylation K583 0.151 _NMQFSNTPDSGVSLLHK(gl)K_
ITSN1 Ubiquitylation K584 -0.412 _NMQFSNTPDSGVSLLHKK(gl)_
ITSN1 Ubiquitylation K596 1.277 _LK(gl)EQLDALEK_
ITSN1 Phosphorylation S889 -0.357 -0.319 _TVSPGSVS(ph)PIHGQGQVVENLK_
ITSN1 Phosphorylation S904 -0.681 -0.729 _SAFTPATATGSSPS(ph)PVLGQGEK_
ITSN1 Phosphorylation S978 1.075 0.684 _STS(ph)MDSGSSESPASLK_
ITSN2 Ubiquitylation K583 0.151 _NMQFSNTPDSGVSLLHK(gl)K_
ITSN2 Ubiquitylation K584 -0.412 _NMQFSNTPDSGVSLLHKK(gl)_
ITSN2 Ubiquitylation K596 1.277 _LK(gl)EQLDALEK_
ITSN2 Phosphorylation S889 -0.357 -0.319 _TVSPGSVS(ph)PIHGQGQVVENLK_
LASP1 Ubiquitylation K42 -0.445 _MTLNMK(gl)NYK_
LASP1 Ubiquitylation K75 0.405 _LK(gl)QQSELQSQVR_
LASP1 Phosphorylation T104 -1.734 _GFSVVADT(ph)PELQR_
LASP1 Phosphorylation S146 0.068 _MGPSGGEGMEPERRDS(ph)QDGSSYR_
LCK Phosphorylation T37 -0.435 _YRPENTPEPVSTSVSHYGAEPT(ph)TVSPCPSSSAK_
LCK Ubiquitylation K191 -0.112 0.264 _ESETTK(gl)GAYSLSIR_
LCK Ubiquitylation K235 0.323 _AQFDTLQK(gl)LVK_
LCK Ubiquitylation K259 -1.613 _LTTVCPTVK(gl)PQTQGLAK_
LYN Ubiquitylation K20 -0.592 _GKDSLSDDGVDLK(gl)TQPVR_
LYN Ubiquitylation K40 0.100 _DPTSNK(gl)QQRPVPESQLLPGQR_
LYN Phosphorylation S104 0.944 0.841 _DSLS(ph)DDGVDLK_
LYN Ubiquitylation K213 0.441 _HYQK(gl)QADGLCR_
LYN Ubiquitylation K477 -0.191 _VENCPDELYDIMK(gl)MCWK_
MCF2L Phosphorylation S90 -0.968 -0.792 _ALEQSQS(ph)LPLPAPT(ph)STSPSR_
MCF2L Phosphorylation S100 -0.927 -0.748 _ALEQSQSLPLPAPTSTS(ph)PSR_
MIA3 Phosphorylation S727 -0.131 -0.291 _VEEDDYPS(ph)EELLEDENAINAK_
MIA3 Ubiquitylation K1477 -0.359 _LLQLK(gl)LR_
MIA3 Ubiquitylation K1485 -0.562 _ASVSTK(gl)CNLEDQVK_
MIA3 Ubiquitylation K1537 -0.142 _EMALQKK(gl)_
MIA3 Ubiquitylation K1723 -0.975 _WSAEASGK(gl)PSPSDPGSGTATMMNSSSR_
MIA3 Phosphorylation S1906 -0.790 -0.967 _DLLPSGSRDEPPPASQSTSQDCSQALKQS(ph)P_
MPP2 Phosphorylation S59 -0.018 0.387 _GIMES(ph)PIVR_
MPP2 Phosphorylation T131 -0.991 _T(ph)YETPPPSPGLDPTFSNQPVPPDAVR_
MPP2 Phosphorylation T134 -0.839 -1.499 _TYET(ph)PPPS(ph)PGLDPTFSNQPVPPDAVR_
MPP2 Phosphorylation S138 -1.041 -1.640 _TYET(ph)PPPS(ph)PGLDPTFSNQPVPPDAVR_
MPP2 Ubiquitylation K583 0.419 _ELQTAMEK(gl)LR_
MPP6 Ubiquitylation K242 0.219 _EAGLK(gl)FSK_
MPP6 Ubiquitylation K403 0.759 _AGK(gl)YLEHGEYEGNLYGTK_
NCK1 Phosphorylation S85 -0.027 -0.877 _RKPS(ph)VPDSASPADDSFVDPGER_
NCK1 Phosphorylation S91 0.493 _RKPSVPDSAS(ph)PADDSFVDPGER_
NCK2 Phosphorylation S90 -0.317 0.054 _DAS(ph)PTPSTDAEYPANGSGADR_
NCKIPSD Phosphorylation T121 0.227 _RGPSASSVAVM(ox)TSST(ph)SDHHLDAAAAR_
NCKIPSD Phosphorylation T180 -1.614 -1.580 _RAAPT(ph)TPPPPVK_
NCKIPSD Phosphorylation T181 -1.595 -1.580 _RAAPT(ph)TPPPPVK_
PACSIN3 Ubiquitylation K148 1.059 _LK(gl)EVEASKK_
PACSIN3 Ubiquitylation K154 0.880 _LKEVEASK(gl)K_
PACSIN3 Phosphorylation S320 0.462 0.580 _GGRS(ph)PDEVTLTSIVPTR_
PACSIN3 Phosphorylation T348 1.778 _DGTAPPPQSPGSPGT(ph)GQDEEWSDEESPRK_
PACSIN3 Phosphorylation S355 -0.685 -0.861 _DGTAPPPQSPGSPGTGQDEEWS(ph)DEESPR_
PLCG1 Ubiquitylation K300 8.031 _DLK(gl)NMLSQVNYR_
PLCG1 Ubiquitylation K348 -0.219 _SLMYSAQK(gl)TMDLPFLEASTLR_
PLCG1 Ubiquitylation K552 -0.355 _NMAQYFK(gl)K_
PLCG1 Ubiquitylation K553 -0.355 _NMAQYFK(gl)K_
PLCG1 Ubiquitylation K1063 0.864 0.355 _LTEGK(gl)IMER_
PLCG1 Phosphorylation S1370 0.475 0.515 _AREGS(ph)FESR_
PPP1R13B Ubiquitylation K102 0.149 _SQDPSLK(gl)R_
PPP1R13B Ubiquitylation K152 0.224 _QQQQIEAQQQLLATK(gl)EQR_
PPP1R13B Ubiquitylation K224 -0.390 _LVEEIEQMNNLFQQK(gl)QR_
PPP1R13B Ubiquitylation K234 -0.113 _ELVLAVSK(gl)VEELTR_
PPP1R13B Ubiquitylation K247 0.193 _VDQLSQQLEDLKK(gl)_
PPP1R13B Ubiquitylation K268 -0.429 _LYK(gl)ELQLR_
PPP1R13B Ubiquitylation K269 -0.833 _LTGPAAVELK(gl)R_
PPP1R13B Ubiquitylation K283 -0.866 _NKLNQEQNAK(gl)LQQQR_
PPP1R13B Ubiquitylation K288 -0.100 -0.011 _NQLNQEQNSK(gl)LQQQK_
PPP1R13B Ubiquitylation K293 -0.061 _LQQQK(gl)ELLNKR_
PPP1R13B Ubiquitylation K303 -0.302 _NSEVAVMDK(gl)R_
PPP1R13B Ubiquitylation K322 -2.045 _AALQQK(gl)ENLPVSSDGNLPQQAASAPSR_
PPP1R13B Phosphorylation S480 0.458 0.944 _NQS(ph)SEDILR_
PPP1R13B Phosphorylation S556 1.443 1.433 _VLLS(ph)PSIPSVGQDQTLSPGSK_
PPP1R13B Phosphorylation S569 1.774 _VLLS(ph)PSIPSVGQDQTLS(ph)PGSK_
PPP1R13B Phosphorylation S698 -0.309 -0.362 _IPRPLS(ph)PTK_
PPP1R13B Phosphorylation T700 -0.449 -0.429 _IPRPLSPT(ph)K_
PPP1R13B Phosphorylation S710 -0.910 -0.515 _RSS(ph)ITEPEGPGGPNIQK_
PPP1R13B Phosphorylation S737 -0.172 -0.748 _RSS(ph)ITEPEGPNGPNIQK_
PTK6 Phosphorylation S47 0.375 0.573 _RDS(ph)LEEGELR_
PTK6 Phosphorylation T61 0.721 _MEIT(ph)IRNSPYR_
PTK6 Phosphorylation S65 0.730 0.552 _MEITIRNS(ph)PYR_
PTK6 Phosphorylation S234 -0.737 -0.712 _S(ph)PPRPPR_
PTK6 Phosphorylation S283 0.324 0.483 _DLLSDLQDIS(ph)DSER_
PTK6 Ubiquitylation K467 -0.286 _TDEIVALK(gl)R_
PTK6 Phosphorylation S589 0.529 0.585 _EYGS(ph)PLKAYT(ph)PVVVTLWYR_
PTK6 Phosphorylation T595 0.472 0.397 _AYT(ph)PVVVTLWYR_
PTK6 Ubiquitylation K672 -1.465 _IWPGYSELPAVK(gl)K_
PTK6 Ubiquitylation K673 -1.465 _IWPGYSELPAVK(gl)K_
PTK6 Ubiquitylation K719 -0.672 _ISAEDGLK(gl)HEYFR_
PTK6 Phosphorylation T751 -0.349 -0.460 _RGT(ph)SPRPPEGGLGYSQLGDDDLK_
PTK6 Phosphorylation S752 -0.526 -0.643 _RGTS(ph)PRPPEGGLGYSQLGDDDLK_
RUSC1 Ubiquitylation K511 -0.990 _NLVQK(gl)AQLGDSR_
RUSC1 Ubiquitylation K803 -1.519 _LFGVPGGPAENENGALK(gl)SR_
SASH1 Phosphorylation S90 -0.391 _RVS(ph)QDLEVEKPDASPTSLQLR_
SASH1 Phosphorylation T405 0.349 _T(ph)CSFGGFDLTNR_
SASH1 Phosphorylation S407 0.394 0.494 _TCS(ph)FGGFDLTNR_
SASH1 Phosphorylation S442 -0.012 0.031 _EVIKS(ph)PTASR_
SASH1 Phosphorylation S813 0.131 0.259 _S(ph)LPVSICR_
SASH1 Phosphorylation S837 -1.576 _S(ph)HSLDDLQVEPGAEQDVPTEVTEPPPQIVPEVPQK_
SASH1 Phosphorylation S839 -1.576 _S(ph)HSLDDLQVEPGAEQDVPTEVTEPPPQIVPEVPQK_
SASH1 Phosphorylation S1051 -1.272 _PLSGQAPGS(ph)PPSTRPPPWLSELPENTSLQEHGVK_
SGSM3 Ubiquitylation K730 -1.056 _EAQQPLK(gl)EGVR_
SH3BP4 Phosphorylation S131 -0.309 _NSTLSDSGMIDNLPDS(ph)PDEVAK_
SH3BP4 Phosphorylation S246 0.304 0.661 _SYS(ph)LSELSVLQAK_
SH3GL1 Ubiquitylation K7 -0.268 _(ac)SVAGLK(gl)K_
SH3GL1 Ubiquitylation K8 -0.654 _(ac)SVAGLKK(gl)_
SH3GL1 Ubiquitylation K76 -0.032 1.606 _LTMLNTVSK(gl)IR_
SH3GL1 Ubiquitylation K177 -0.477 0.450 _QGK(gl)IPDEELR_
SH3GL1 Phosphorylation S287 -0.011 0.143 _IAASS(ph)SFR_
SH3GL1 Phosphorylation S288 0.348 -0.194 _IAASSS(ph)FR_
SH3GL2 Ubiquitylation K7 -0.268 _(ac)SVAGLK(gl)K_
SH3GL2 Ubiquitylation K8 -0.654 _(ac)SVAGLKK(gl)_
SH3GL2 Ubiquitylation K177 -0.477 0.450 _QGK(gl)IPDEELR_
SH3GL3 Ubiquitylation K7 -0.268 _(ac)SVAGLK(gl)K_
SH3GL3 Ubiquitylation K8 -0.654 _(ac)SVAGLKK(gl)_
SH3GLB1 Ubiquitylation K10 -0.072 _(ac)MNIMDFNVKK(gl)_
SH3GLB2 Ubiquitylation K7 0.225 _(ac)MDFNMKK(gl)_
SH3GLB2 Ubiquitylation K185 -0.759 _AAEAK(gl)ATTVPDFQETRPR_
SH3KBP1 Phosphorylation S230 0.300 0.186 _S(ph)IEVENDFLPVEK_
SH3PXD2A Ubiquitylation K282 0.122 _YVTVQPYTSQSK(gl)DEIGFEK_
SH3PXD2A Phosphorylation S421 0.568 0.137 _AQISS(ph)PNLR_
SH3PXD2A Phosphorylation S515 0.383 _RTS(ph)TLTRPK_
SH3PXD2B Phosphorylation S770 -3.158 _KTSS(ph)SSRPLPEVR_
SH3RF1 Phosphorylation S735 -0.929 _VS(ph)PPAS(ph)PTLEVELGSAELPLQGAVGPELPPGGGHGR_
SH3RF1 Phosphorylation S739 -0.818 _VS(ph)PPAS(ph)PTLEVELGSAELPLQGAVGPELPPGGGHGR_
SH3RF1 Phosphorylation T741 -1.041 _VS(ph)PPASPT(ph)LEVELGSAELPLQGAVGPELPPGGGHGR_
SH3RF3 Phosphorylation S797 -0.473 _AGS(ph)LDLNFTSPSR_
SKAP2 Ubiquitylation K125 0.222 _AGYLEK(gl)R_
SNX18 Ubiquitylation K466 -0.225 _EYQK(gl)VGQSFR_
SNX9 Ubiquitylation K179 0.445 _SSSYFK(gl)DSESADAGGAQR_
SNX9 Phosphorylation S198 0.523 _ASS(ph)SSMKIPLNK_
SORBS1 Phosphorylation S57 -0.823 0.018 _ETPSSSPAS(ph)PQETR_
SORBS1 Phosphorylation S548 -0.502 -0.518 _RVGEQDSAPTQEKPTS(ph)PGK_
SORBS3 Phosphorylation S6 0.282 -0.078 _(ac)ADGGS(ph)PFLGRR_
SORBS3 Phosphorylation S109 -1.018 _LKFDFQAQS(ph)PK_
SORBS3 Phosphorylation T243 -0.650 -0.441 _LCDDGPQLPT(ph)SPR_
SORBS3 Phosphorylation S244 -0.506 -0.252 _LCDDGPQLPTS(ph)PR_
SORBS3 Phosphorylation S258 -0.155 0.017 _HPS(ph)SPSALR_
SORBS3 Phosphorylation S259 -0.175 -0.164 _HPSS(ph)PSALR_
SPTAN1 Ubiquitylation K864 -0.012 _GNAMVEEGHFAAEDVKAK(gl)_
SPTAN1 Phosphorylation S1029 1.169 1.417 _LDPAQS(ph)ASRENLLEEQGSIALR_
SPTAN1 Phosphorylation S1031 1.169 1.397 _LDPAQSAS(ph)RENLLEEQGSIALR_
SPTAN1 Ubiquitylation K1187 0.393 -0.095 _DETDSK(gl)TASPWK_
SPTAN1 Ubiquitylation K1193 0.677 0.204 _TASPWK(gl)SAR_
SPTAN1 Phosphorylation S1217 0.717 0.823 _WRS(ph)LQQLAEER_
SPTAN1 Ubiquitylation K2057 1.535 0.543 _HVQSK(gl)AIEAR_
SRC Phosphorylation S17 -0.604 -0.689 _S(ph)LEPAENVHGAGGGAFPASQTPSKPASADGHR_
SRC Phosphorylation S75 0.060 0.331 _LFGGFNSSDTVTS(ph)PQR_
STAM2 Ubiquitylation K182 -0.024 -0.067 _AIELSLQEQK(gl)QQHTETK_
STAM2 Ubiquitylation K189 -0.345 -0.068 _QQHTETK(gl)SLYPSSEIQLNNK_
STAM2 Ubiquitylation K202 -0.516 -0.231 _SLYPSSEIQLNNK(gl)VAR_
TJP1 Ubiquitylation K54 0.081 -0.398 _GSLLPLK(gl)R_
TJP1 Ubiquitylation K157 0.023 -0.755 _SEK(gl)IWPR_
TJP1 Phosphorylation S175 0.113 -0.041 _S(ph)VASSQPAKPTK_
TJP1 Ubiquitylation K187 -0.394 _SVASSQPAK(gl)PTK_
TJP1 Ubiquitylation K198 0.760 0.143 _SRK(gl)NEEYGLR_
TJP1 Phosphorylation S329 -0.569 -0.354 _HS(ph)PQQPSNGSLR_
TJP1 Phosphorylation S353 -0.522 -0.375 _ISKPGAVS(ph)TPVK_
TJP1 Phosphorylation S617 0.438 0.543 _S(ph)REDLSAQPVQTK_
TJP1 Ubiquitylation K677 -0.484 _EEPDIYQIAK(gl)SEPR_
TJP1 Phosphorylation S912 -0.113 _IDS(ph)PGFKPASQQK_
TJP1 Phosphorylation S916 -0.049 0.102 _IDS(ph)PGFKPASQQVYR_
TJP1 Ubiquitylation K920 7.379 6.153 _IDSPGFK(gl)PASQQVYR_
TJP1 Phosphorylation S968 -0.778 _LEEPTPAPSTSYS(ph)PQADSLR_
TJP1 Phosphorylation S1579 0.045 -0.197 _SHS(ph)LAQPPEFDSGVETFSIHAEKPK_
TJP1 Phosphorylation S1617 0.665 _AIPVS(ph)PSAVEEDEDEDGHTVVATAR_
TJP2 Phosphorylation S161 -0.169 -0.024 _VQVAALQAS(ph)PPLDQDDR_
TJP2 Phosphorylation S205 0.118 0.563 _SWEDS(ph)PER_
TJP2 Phosphorylation S275 0.891 0.690 _GRS(ph)IDQDYER_
TJP2 Phosphorylation S297 0.478 0.579 _AYS(ph)PEYR_
TJP2 Phosphorylation S446 0.631 _SFS(ph)PEER_
TJP2 Phosphorylation S471 -0.863 0.159 _ERPS(ph)SREDTPSR_
TJP2 Phosphorylation S472 -0.715 0.193 _ERPSS(ph)REDTPSR_
TJP2 Ubiquitylation K506 -0.355 -0.981 _STGDIAGTVVPETNK(gl)EPR_
TJP2 Ubiquitylation K520 -1.549 _YQEEPPAPQPK(gl)AAPR_
TJP2 Ubiquitylation K800 -0.173 0.403 _DAGSEK(gl)STGVVR_
TJP2 Phosphorylation S992 -0.733 _SSEPVQHEES(ph)IRKPSPEPR_
TJP2 Phosphorylation S997 -1.075 -0.616 _SSEPVQHEESIRKPS(ph)PEPR_
TJP2 Phosphorylation S1017 -1.379 -1.918 _DNS(ph)PPPAFKPEPPK_
TJP2 Ubiquitylation K1047 -0.374 -0.833 _SYEYK(gl)SNPSAVAGNETPGASTK_
TJP2 Phosphorylation S1187 0.856 _GS(ph)YGSDAEEEEYRQQLSEHSK_
TJP2 Phosphorylation S1190 0.754 0.727 _GSYGS(ph)DAEEEEYRQQLSEHSK_
TP53BP2 Ubiquitylation K102 0.149 _SQDPSLK(gl)R_
TP53BP2 Ubiquitylation K152 0.224 _QQQQIEAQQQLLATK(gl)EQR_
TP53BP2 Ubiquitylation K224 -0.390 _LVEEIEQMNNLFQQK(gl)QR_
TP53BP2 Ubiquitylation K234 -0.113 _ELVLAVSK(gl)VEELTR_
TP53BP2 Ubiquitylation K268 -0.429 _LYK(gl)ELQLR_
TP53BP2 Ubiquitylation K283 -0.866 _NKLNQEQNAK(gl)LQQQR_
TP53BP2 Ubiquitylation K303 -0.302 _NSEVAVMDK(gl)R_
TP53BP2 Ubiquitylation K322 -2.045 _AALQQK(gl)ENLPVSSDGNLPQQAASAPSR_
TP53BP2 Phosphorylation S480 0.458 0.944 _NQS(ph)SEDILR_
TP53BP2 Phosphorylation S556 1.443 1.433 _VLLS(ph)PSIPSVGQDQTLSPGSK_
TP53BP2 Phosphorylation S569 1.774 _VLLS(ph)PSIPSVGQDQTLS(ph)PGSK_
TP53BP2 Phosphorylation S698 -0.309 -0.362 _IPRPLS(ph)PTK_
TP53BP2 Phosphorylation T700 -0.449 -0.429 _IPRPLSPT(ph)K_
TP53BP2 Phosphorylation S737 -0.172 -0.748 _RSS(ph)ITEPEGPNGPNIQK_
YES1 Phosphorylation T37 -0.435 _YRPENTPEPVSTSVSHYGAEPT(ph)TVSPCPSSSAK_
YES1 Ubiquitylation K191 -0.112 0.264 _ESETTK(gl)GAYSLSIR_
YES1 Ubiquitylation K235 0.323 _AQFDTLQK(gl)LVK_
YES1 Ubiquitylation K259 -1.613 _LTTVCPTVK(gl)PQTQGLAK_
ZDHHC6 Ubiquitylation K353 -0.307 _IQLQK(gl)GEFILATR_


© Copyright Svejstrup Laboratory 2015