bioLOGIC Data » bioLOGIC CategoryView » bioLOGIC VennView » Experimental Details »

bioLOGIC Data

bioLOGIC Data


Exact search


Query: DLG2

RNAi screen result RNAPII IP (PI) CSB IP CSB IP (PI) Chrom. Chrom. (PI) Phosphorylation Ubiquitylation
W
[Click on the plots to view the data selection in the respective scatterplot]

Protein Results:

 Results for post-translational modifications: see below | Red/green: hit at lower/upper end of the respective screen
Gene name Point score Z-score sums RNAi high RNAi low RNAPII-IP (PI) CSB-IP CSB-IP (PI) Chrom. Chrom. (PI)
DLG2 1 6.310 -0.710 1.560 1.552 0.102 0.488
DLG2 1 6.310 1.570 -1.220 1.552 0.102 0.488

PTM Sites:

 Back to Protein Results | Red/green: hit at lower/upper end of the respective screen
Gene name PTM type PTM site UV UV (PI) Sequence
DLG2 Ubiquitylation K321 1.264 1.435 _IMEIK(gl)LIK_
DLG2 Phosphorylation S158 0.773 _NLSEIENVHGFVSHSHIS(ph)PIK_
DLG2 Phosphorylation S575 0.255 0.729 _EQMMNSSISSGSGS(ph)LR_
DLG2 Phosphorylation S122 -1.073 _YQDEDTPPQEHIS(ph)PQITNEVIGPELVHVSEK_
DLG2 Phosphorylation T115 -0.707 -1.378 _YQDEDT(ph)PPQEHISPQITNEVIGPELVHVSEK_
DLG2 Phosphorylation S102 -1.455 _SKPSEPIQPVNTWEISSLPSSTVTSETLPSSLS(ph)PSVEK_
DLG2 Ubiquitylation K361 0.180 _IIEGGAAHK(gl)DGK_
DLG2 Ubiquitylation K452 -0.704 _YSPVSK(gl)AVLGDDEITREPR_
DLG2 Ubiquitylation K556 0.105 _FEAK(gl)IHDLR_
DLG2 Phosphorylation S573 0.697 _EQM(ox)M(ox)NSSISSGS(ph)GSLR_
DLG2 Ubiquitylation K843 1.259 _SMENIMEMNK(gl)R_

Background Information for DLG2:


Pubmed-DLG2 »
Uniprot-DLG2 »
Biogrid-DLG2 »
ProteomicsDB-DLG2 »

Tumorportal-DLG2 »
COSMIC-DLG2 »
GenomeRNAi-DLG2 »
Genecards-DLG2


Protein-protein Interactions for DLG2
Show screen data for Category Name and Description Link to cat description Data Source


Protein Domains in DLG2
Domain name Domain Description TC-NER relevance -log10(p-value)
Category members P-loop_NTPase IPR027417 2.83
Category members L27 IPR004172 1.84
Category members GK/Ca_channel_bsu IPR008145 1.36
Category members Guanylate_kin-like IPR008144 1.32
Category members DLG1 IPR016313 0.2
Category members PDZ_assoc IPR019583 0.2
Category members MAGUK_PEST_N IPR019590 0.2
Category members PDZ IPR001478 0.15
Category members L27_1 IPR015143 0.12
Category members SH3_2 IPR011511 0.08
Category members SH3_domain IPR001452 0


Protein complexes (CORUM database) featuring DLG2
Category Type Category ID Category Name Data Source TC-NER relevance -log10(p-value)


Categories featuring DLG2
Category Type Category ID Category Name Data Source TC-NER relevance -log10(p-value)
Category members GO Category GO:0005515 protein binding Database INF
Category members GO Category GO:0004385 guanylate kinase activity Database 1.77
Category members GO Category GO:0005886 plasma membrane Database 1.21
Category members GO Category GO:0007268 synaptic transmission Database 0.23
Category members GO Category GO:0045211 postsynaptic membrane Database 0.06
Category members GO Category GO:0019233 sensory perception of pain Database 0.05
Category members GO Category GO:0010923 negative regulation of phosphatase activity Database 0
Category members GO Category GO:0014069 postsynaptic density Database 0
Category members GO Category GO:0030054 cell junction Database 0
Category members GO Category GO:0044224 juxtaparanode region of axon Database 0


.

© Copyright Svejstrup Laboratory 2015