bioLOGIC Data » bioLOGIC CategoryView » bioLOGIC VennView » Experimental Details »
bioLOGIC Category

Results for the Category
sensory perception of pain
(GO:0019233)

RNAi screen result RNAPII IP (MG132) CSB IP CSB IP (MG132) Chrom. Chrom. (MG132) Ubi /Phospo Ubi /Phospho (MG132)
W

Protein Results:

Results for post-translational modifications (below)
Gene name MGoogle Score RNAi high RNAi low RNAPII-IP (MG132) CSB-IP CSB-IP (MG132) Chrom. Chrom. (MG132)
DLG2 1 -0.710 1.560 1.552 0.102 0.488
DLG2 1 1.570 -1.220 1.552 0.102 0.488
MAPK3 0
UCHL1 0 -0.500 0.500 1.153 -0.238
UCHL1 0 -0.500 0.500 0.687
CDK5 0 -1.100 1.740 -0.236 1.063 0.312
NLGN2 0 0.140 0.230
NIPSNAP1 0 -1.030 0.980 0.793 -0.869 -0.958 0.711 0.588
POMK 0 0.330 -0.200

PTM Sites:

Back to Protein Results
Gene name PTM type PTM site UV UV (MG132) Sequence
CDK5 Ubiquitylation K56 0.606 0.237 _EICLLK(gl)ELK_
DLG2 Phosphorylation S102 -1.455 _SKPSEPIQPVNTWEISSLPSSTVTSETLPSSLS(ph)PSVEK_
DLG2 Phosphorylation T115 -0.707 -1.378 _YQDEDT(ph)PPQEHISPQITNEVIGPELVHVSEK_
DLG2 Phosphorylation S122 -1.073 _YQDEDTPPQEHIS(ph)PQITNEVIGPELVHVSEK_
DLG2 Phosphorylation S158 0.773 _NLSEIENVHGFVSHSHIS(ph)PIK_
DLG2 Ubiquitylation K321 1.264 1.435 _IMEIK(gl)LIK_
DLG2 Ubiquitylation K361 0.180 _IIEGGAAHK(gl)DGK_
DLG2 Ubiquitylation K452 -0.704 _YSPVSK(gl)AVLGDDEITREPR_
DLG2 Ubiquitylation K556 0.105 _FEAK(gl)IHDLR_
DLG2 Phosphorylation S573 0.697 _EQM(ox)M(ox)NSSISSGS(ph)GSLR_
DLG2 Phosphorylation S575 0.255 0.729 _EQMMNSSISSGSGS(ph)LR_
DLG2 Ubiquitylation K843 1.259 _SMENIMEMNK(gl)R_
MAPK3 Phosphorylation Y204 -0.807 -2.487 _IADPEHDHTGFLTEY(ph)VATR_
MAPK3 Ubiquitylation K289 -0.608 _NYLQSLPSKTK(gl)_
NLGN2 Ubiquitylation K748 0.088 _ELPPEEELVSLQLK(gl)R_
POMK Ubiquitylation K3 -1.357 -0.509 _(ac)MEK(gl)QPQNSR_
POMK Ubiquitylation K93 0.734 _VGEGAVK(gl)R_
UCHL1 Ubiquitylation K4 -0.164 -0.657 _MQLK(gl)PMEINPEMLNK_
UCHL1 Ubiquitylation K65 -0.004 -0.789 _K(gl)QIEELKGQEVSPK_
UCHL1 Ubiquitylation K71 -0.121 -0.325 _QIEELK(gl)GQEVSPK_
UCHL1 Ubiquitylation K78 -0.595 _QIEELKGQEVSPK(gl)VYFMK_
UCHL1 Ubiquitylation K123 -0.013 -0.297 _QFLSETEK(gl)M(ox)SPEDR_
UCHL1 Ubiquitylation K135 -0.048 _CFEK(gl)NEAIQAAHDAVAQEGQCR_
UCHL1 Ubiquitylation K195 -0.285 -0.704 _MPFPVNHGASSEDTLLK(gl)DAAK_
UCHL1 Ubiquitylation K221 -0.155 -0.216 _FSAVALCK(gl)AA_


© Copyright Svejstrup Laboratory 2015