bioLOGIC Data » bioLOGIC CategoryView » bioLOGIC VennView » Experimental Details »

bioLOGIC Data

bioLOGIC Data


Exact search


Query: DLG4

RNAi screen result RNAPII IP (PI) CSB IP CSB IP (PI) Chrom. Chrom. (PI) Phosphorylation Ubiquitylation
W
[Click on the plots to view the data selection in the respective scatterplot]

Protein Results:

 Results for post-translational modifications: see below | Red/green: hit at lower/upper end of the respective screen
Gene name Point score Z-score sums RNAi high RNAi low RNAPII-IP (PI) CSB-IP CSB-IP (PI) Chrom. Chrom. (PI)
DLG4 1 6.630 -0.020 0.320 1.552 0.102 0.488

PTM Sites:

 Back to Protein Results | Red/green: hit at lower/upper end of the respective screen
Gene name PTM type PTM site UV UV (PI) Sequence
DLG4 Ubiquitylation K321 1.264 1.435 _IMEIK(gl)LIK_
DLG4 Phosphorylation S158 0.773 _NLSEIENVHGFVSHSHIS(ph)PIK_
DLG4 Phosphorylation S575 0.255 0.729 _EQMMNSSISSGSGS(ph)LR_
DLG4 Phosphorylation S122 -1.073 _YQDEDTPPQEHIS(ph)PQITNEVIGPELVHVSEK_
DLG4 Phosphorylation T115 -0.707 -1.378 _YQDEDT(ph)PPQEHISPQITNEVIGPELVHVSEK_
DLG4 Phosphorylation S102 -1.455 _SKPSEPIQPVNTWEISSLPSSTVTSETLPSSLS(ph)PSVEK_
DLG4 Ubiquitylation K361 0.180 _IIEGGAAHK(gl)DGK_
DLG4 Ubiquitylation K452 -0.704 _YSPVSK(gl)AVLGDDEITREPR_
DLG4 Ubiquitylation K556 0.105 _FEAK(gl)IHDLR_
DLG4 Phosphorylation S573 0.697 _EQM(ox)M(ox)NSSISSGS(ph)GSLR_
DLG4 Ubiquitylation K843 1.259 _SMENIMEMNK(gl)R_

Background Information for DLG4:


Pubmed-DLG4 »
Uniprot-DLG4 »
Biogrid-DLG4 »
ProteomicsDB-DLG4 »

Tumorportal-DLG4 »
COSMIC-DLG4 »
GenomeRNAi-DLG4 »
Genecards-DLG4


Protein-protein Interactions for DLG4
Show screen data for Category Name and Description Link to cat description Data Source


Protein Domains in DLG4
Domain name Domain Description TC-NER relevance -log10(p-value)
Category members P-loop_NTPase IPR027417 2.83
Category members GK/Ca_channel_bsu IPR008145 1.36
Category members Guanylate_kin-like IPR008144 1.32
Category members DLG1 IPR016313 0.2
Category members PDZ_assoc IPR019583 0.2
Category members MAGUK_PEST_N IPR019590 0.2
Category members PDZ IPR001478 0.15
Category members L27_1 IPR015143 0.12
Category members SH3_2 IPR011511 0.08
Category members SH3_domain IPR001452 0


Protein complexes (CORUM database) featuring DLG4
Category Type Category ID Category Name Data Source TC-NER relevance -log10(p-value)
Category members Corum 1909 APC-DLG4 complex Database 0
Category members Corum 5641 PSD95-FYN-NR2A complex Database 0


Categories featuring DLG4
Category Type Category ID Category Name Data Source TC-NER relevance -log10(p-value)
Category members GO Category GO:0005515 protein binding Database INF
Category members GO Category GO:0005737 cytoplasm Database 12.81
Category members GO Category GO:0008022 protein C-terminus binding Database 1.43
Category members GO Category GO:0005886 plasma membrane Database 1.21
Category members GO Category GO:0005783 endoplasmic reticulum Database 0.62
Category members GO Category GO:0006461 protein complex assembly Database 0.57
Category members GO Category GO:0016020 membrane Database 0.52
Category members GO Category GO:0032403 protein complex binding Database 0.49
Category members Pathway Pathway_32 KEGG_HUNTINGTONS_DISEASE 0 0.46
Category members GO Category GO:0019903 protein phosphatase binding Database 0.33
Category members GO Category GO:0030165 PDZ domain binding Database 0.29
Category members GO Category GO:0008021 synaptic vesicle Database 0.28
Category members GO Category GO:0030863 cortical cytoskeleton Database 0.24
Category members GO Category GO:0007268 synaptic transmission Database 0.23
Category members GO Category GO:0033130 acetylcholine receptor binding Database 0.19
Category members GO Category GO:0007411 axon guidance Database 0.13
Category members GO Category GO:0045944 positive regulation of transcription from RNA polymerase II promoter Database 0.13
Category members GO Category GO:0031234 extrinsic to cytoplasmic side of plasma membrane Database 0.1
Category members GO Category GO:0045184 establishment of protein localization Database 0.1
Category members Pathway Pathway_735 ST_MYOCYTE_AD_PATHWAY 0 0.09
Category members GO Category GO:0030666 endocytic vesicle membrane Database 0.08
Category members GO Category GO:0045211 postsynaptic membrane Database 0.06
Category members GO Category GO:0045202 synapse Database 0.06
Category members GO Category GO:0035641 locomotory exploration behavior Database 0.04
Category members GO Category GO:0050885 neuromuscular process controlling balance Database 0.02
Category members Pathway Pathway_421 BIOCARTA_NOS1_PATHWAY 0 0
Category members Pathway Pathway_609 PID_ERBB4_PATHWAY 0 0
Category members Pathway Pathway_658 ST_GA13_PATHWAY 0 0
Category members Pathway Pathway_725 ST_GA12_PATHWAY 0 0
Category members GO Category GO:0001973 adenosine receptor signaling pathway Database 0
Category members GO Category GO:0002091 negative regulation of receptor internalization Database 0
Category members GO Category GO:0005102 receptor binding Database 0
Category members GO Category GO:0007165 signal transduction Database 0
Category members GO Category GO:0007204 positive regulation of cytosolic calcium ion concentration Database 0
Category members GO Category GO:0007399 nervous system development Database 0
Category members GO Category GO:0007612 learning Database 0
Category members GO Category GO:0008328 ionotropic glutamate receptor complex Database 0
Category members GO Category GO:0014069 postsynaptic density Database 0
Category members GO Category GO:0016188 synaptic vesicle maturation Database 0
Category members GO Category GO:0030054 cell junction Database 0
Category members GO Category GO:0031697 beta-1 adrenergic receptor binding Database 0
Category members GO Category GO:0031748 D1 dopamine receptor binding Database 0
Category members GO Category GO:0032281 alpha-amino-3-hydroxy-5-methyl-4-isoxazolepropionic acid selective glutamate receptor complex Database 0
Category members GO Category GO:0032839 dendrite cytoplasm Database 0
Category members GO Category GO:0035176 social behavior Database 0
Category members GO Category GO:0035254 glutamate receptor binding Database 0
Category members GO Category GO:0035255 ionotropic glutamate receptor binding Database 0
Category members GO Category GO:0035418 protein localization to synapse Database 0
Category members GO Category GO:0044224 juxtaparanode region of axon Database 0
Category members GO Category GO:0044306 neuron projection terminus Database 0
Category members GO Category GO:0044309 neuron spine Database 0
Category members GO Category GO:0045031 ATP-activated nucleotide receptor activity Database 0
Category members GO Category GO:0045032 ADP-activated nucleotide receptor activity Database 0
Category members GO Category GO:0048169 regulation of long-term neuronal synaptic plasticity Database 0
Category members GO Category GO:0050806 positive regulation of synaptic transmission Database 0
Category members GO Category GO:0060076 excitatory synapse Database 0
Category members GO Category GO:0060997 dendritic spine morphogenesis Database 0


.

© Copyright Svejstrup Laboratory 2015