bioLOGIC Data » bioLOGIC CategoryView » bioLOGIC VennView » Experimental Details »
bioLOGIC Category

Results for the Category
dendritic spine morphogenesis
(GO:0060997)

RNAi screen result RNAPII IP (MG132) CSB IP CSB IP (MG132) Chrom. Chrom. (MG132) Ubi /Phospo Ubi /Phospho (MG132)
W

Protein Results:

Results for post-translational modifications (below)
Gene name MGoogle Score RNAi high RNAi low RNAPII-IP (MG132) CSB-IP CSB-IP (MG132) Chrom. Chrom. (MG132)
DLG4 1 -0.020 0.320 1.552 0.102 0.488
EPHB2 0 -0.630 0.780 0.221
EPHB2 0 -0.630 0.780
EPHB1 0 -0.220 0.000 0.221
EPHB1 0 -0.220 0.000 -0.042
EPHB1 0 -0.220 0.000
EPHB3 0 0.800 -0.380 0.221
EPHB3 0 0.800 -0.380

PTM Sites:

Back to Protein Results
Gene name PTM type PTM site UV UV (MG132) Sequence
DLG4 Phosphorylation S102 -1.455 _SKPSEPIQPVNTWEISSLPSSTVTSETLPSSLS(ph)PSVEK_
DLG4 Phosphorylation T115 -0.707 -1.378 _YQDEDT(ph)PPQEHISPQITNEVIGPELVHVSEK_
DLG4 Phosphorylation S122 -1.073 _YQDEDTPPQEHIS(ph)PQITNEVIGPELVHVSEK_
DLG4 Phosphorylation S158 0.773 _NLSEIENVHGFVSHSHIS(ph)PIK_
DLG4 Ubiquitylation K321 1.264 1.435 _IMEIK(gl)LIK_
DLG4 Ubiquitylation K361 0.180 _IIEGGAAHK(gl)DGK_
DLG4 Ubiquitylation K452 -0.704 _YSPVSK(gl)AVLGDDEITREPR_
DLG4 Ubiquitylation K556 0.105 _FEAK(gl)IHDLR_
DLG4 Phosphorylation S573 0.697 _EQM(ox)M(ox)NSSISSGS(ph)GSLR_
DLG4 Phosphorylation S575 0.255 0.729 _EQMMNSSISSGSGS(ph)LR_
DLG4 Ubiquitylation K843 1.259 _SMENIMEMNK(gl)R_
EPHB1 Ubiquitylation K578 -0.752 -0.618 _QSPEDVYFSK(gl)SEQLKPLK_
EPHB1 Ubiquitylation K583 0.445 0.124 _SEQLK(gl)PLK_
EPHB1 Ubiquitylation K617 0.339 _QK(gl)VIGAGEFGEVYK_
EPHB1 Ubiquitylation K649 -1.219 _TLK(gl)AGYTEK_
EPHB1 Ubiquitylation K657 0.533 _LKLPGK(gl)R_
EPHB1 Phosphorylation S897 0.000 _LPS(ph)TSGSEGVPFR_
EPHB1 Phosphorylation T898 -0.329 0.424 _LPST(ph)SGSEGVPFR_
EPHB2 Ubiquitylation K578 -0.752 -0.618 _QSPEDVYFSK(gl)SEQLKPLK_
EPHB2 Ubiquitylation K583 0.445 0.124 _SEQLK(gl)PLK_
EPHB2 Ubiquitylation K617 0.339 _QK(gl)VIGAGEFGEVYK_
EPHB2 Ubiquitylation K649 -1.219 _TLK(gl)AGYTEK_
EPHB2 Phosphorylation S776 -0.147 -0.171 _FLEDDTS(ph)DPTYTSALGGK_
EPHB2 Phosphorylation S897 0.000 _LPS(ph)TSGSEGVPFR_
EPHB2 Phosphorylation T898 -0.329 0.424 _LPST(ph)SGSEGVPFR_
EPHB3 Ubiquitylation K578 -0.752 -0.618 _QSPEDVYFSK(gl)SEQLKPLK_
EPHB3 Ubiquitylation K583 0.445 0.124 _SEQLK(gl)PLK_
EPHB3 Ubiquitylation K617 0.339 _QK(gl)VIGAGEFGEVYK_
EPHB3 Ubiquitylation K649 -1.219 _TLK(gl)AGYTEK_
EPHB3 Phosphorylation S897 0.000 _LPS(ph)TSGSEGVPFR_
EPHB3 Phosphorylation T898 -0.329 0.424 _LPST(ph)SGSEGVPFR_
EPHB3 Ubiquitylation K960 0.133 _IGVTLAGHQKK(gl)_


© Copyright Svejstrup Laboratory 2015