bioLOGIC Data » bioLOGIC CategoryView » bioLOGIC VennView » Experimental Details »
bioLOGIC Category

Results for the Category
glutamate receptor binding
(GO:0035254)

RNAi screen result RNAPII IP (MG132) CSB IP CSB IP (MG132) Chrom. Chrom. (MG132) Ubi /Phospo Ubi /Phospho (MG132)
W

Protein Results:

Results for post-translational modifications (below)
Gene name MGoogle Score RNAi high RNAi low RNAPII-IP (MG132) CSB-IP CSB-IP (MG132) Chrom. Chrom. (MG132)
PLCG1 1 -0.170 0.000
DLG4 1 -0.020 0.320 1.552 0.102 0.488
CAMK2A 0 -0.430 0.130 -0.654 0.073
CAMK2A 0 -0.430 0.130 -0.619 0.544 0.125
MYL12A 0 -0.110 -0.420 -0.507 0.247 -0.166
MYL12A 0 0.120 0.240 -0.507 0.247 -0.166
HOMER2 0 0.090 -0.230 0.265
HOMER2 0 0.090 -0.230 -1.166

PTM Sites:

Back to Protein Results
Gene name PTM type PTM site UV UV (MG132) Sequence
CAMK2A Ubiquitylation K251 -0.437 _DLINK(gl)MLTINPAK_
DLG4 Phosphorylation S102 -1.455 _SKPSEPIQPVNTWEISSLPSSTVTSETLPSSLS(ph)PSVEK_
DLG4 Phosphorylation T115 -0.707 -1.378 _YQDEDT(ph)PPQEHISPQITNEVIGPELVHVSEK_
DLG4 Phosphorylation S122 -1.073 _YQDEDTPPQEHIS(ph)PQITNEVIGPELVHVSEK_
DLG4 Phosphorylation S158 0.773 _NLSEIENVHGFVSHSHIS(ph)PIK_
DLG4 Ubiquitylation K321 1.264 1.435 _IMEIK(gl)LIK_
DLG4 Ubiquitylation K361 0.180 _IIEGGAAHK(gl)DGK_
DLG4 Ubiquitylation K452 -0.704 _YSPVSK(gl)AVLGDDEITREPR_
DLG4 Ubiquitylation K556 0.105 _FEAK(gl)IHDLR_
DLG4 Phosphorylation S573 0.697 _EQM(ox)M(ox)NSSISSGS(ph)GSLR_
DLG4 Phosphorylation S575 0.255 0.729 _EQMMNSSISSGSGS(ph)LR_
DLG4 Ubiquitylation K843 1.259 _SMENIMEMNK(gl)R_
MYL12A Phosphorylation T19 0.111 0.686 _AT(ph)SNVFAMFDQSQIQEFK_
MYL12A Phosphorylation S20 0.129 0.526 _ATS(ph)NVFAM(ox)FDQSQIQEFK_
MYL12A Ubiquitylation K150 -0.522 _EAPIDK(gl)KGNFNYIEFTR_
MYL12A Ubiquitylation K151 -0.241 0.032 _K(gl)GNFNYIEFTR_
PLCG1 Ubiquitylation K300 8.031 _DLK(gl)NMLSQVNYR_
PLCG1 Ubiquitylation K348 -0.219 _SLMYSAQK(gl)TMDLPFLEASTLR_
PLCG1 Ubiquitylation K552 -0.355 _NMAQYFK(gl)K_
PLCG1 Ubiquitylation K553 -0.355 _NMAQYFK(gl)K_
PLCG1 Ubiquitylation K1063 0.864 0.355 _LTEGK(gl)IMER_
PLCG1 Phosphorylation S1370 0.475 0.515 _AREGS(ph)FESR_


© Copyright Svejstrup Laboratory 2015