bioLOGIC Data » bioLOGIC CategoryView » bioLOGIC VennView » Experimental Details »
bioLOGIC Category

Results for the Category
ST_GA12_PATHWAY
(Pathway_725)

RNAi screen result RNAPII IP (MG132) CSB IP CSB IP (MG132) Chrom. Chrom. (MG132) Ubi /Phospo Ubi /Phospho (MG132)
W

Protein Results:

Results for post-translational modifications (below)
Gene name MGoogle Score RNAi high RNAi low RNAPII-IP (MG132) CSB-IP CSB-IP (MG132) Chrom. Chrom. (MG132)
JUN 3 -0.930 0.930 -0.126
PLD2 1 -0.390 -0.250
RAF1 1 2.020 -1.230
DLG4 1 -0.020 0.320 1.552 0.102 0.488
PLD1 0 -0.150 -0.140
MYEF2 0 -0.766 -1.685 -0.392 -0.108 0.500
PLD3 0 0.580 -0.500 0.750 1.478 -0.218 -0.381 0.343
EPHB2 0 -0.630 0.780 0.221
EPHB2 0 -0.630 0.780
F2RL1 0 -1.330 2.490
SRC 0 0.050 0.470 -0.031
CFB 0 -0.380 -0.210

PTM Sites:

Back to Protein Results
Gene name PTM type PTM site UV UV (MG132) Sequence
CFB Ubiquitylation K808 -6.292 _VASYGVK(gl)PR_
DLG4 Phosphorylation S102 -1.455 _SKPSEPIQPVNTWEISSLPSSTVTSETLPSSLS(ph)PSVEK_
DLG4 Phosphorylation T115 -0.707 -1.378 _YQDEDT(ph)PPQEHISPQITNEVIGPELVHVSEK_
DLG4 Phosphorylation S122 -1.073 _YQDEDTPPQEHIS(ph)PQITNEVIGPELVHVSEK_
DLG4 Phosphorylation S158 0.773 _NLSEIENVHGFVSHSHIS(ph)PIK_
DLG4 Ubiquitylation K321 1.264 1.435 _IMEIK(gl)LIK_
DLG4 Ubiquitylation K361 0.180 _IIEGGAAHK(gl)DGK_
DLG4 Ubiquitylation K452 -0.704 _YSPVSK(gl)AVLGDDEITREPR_
DLG4 Ubiquitylation K556 0.105 _FEAK(gl)IHDLR_
DLG4 Phosphorylation S573 0.697 _EQM(ox)M(ox)NSSISSGS(ph)GSLR_
DLG4 Phosphorylation S575 0.255 0.729 _EQMMNSSISSGSGS(ph)LR_
DLG4 Ubiquitylation K843 1.259 _SMENIMEMNK(gl)R_
EPHB2 Ubiquitylation K578 -0.752 -0.618 _QSPEDVYFSK(gl)SEQLKPLK_
EPHB2 Ubiquitylation K583 0.445 0.124 _SEQLK(gl)PLK_
EPHB2 Ubiquitylation K617 0.339 _QK(gl)VIGAGEFGEVYK_
EPHB2 Ubiquitylation K649 -1.219 _TLK(gl)AGYTEK_
EPHB2 Phosphorylation S776 -0.147 -0.171 _FLEDDTS(ph)DPTYTSALGGK_
EPHB2 Phosphorylation S897 0.000 _LPS(ph)TSGSEGVPFR_
EPHB2 Phosphorylation T898 -0.329 0.424 _LPST(ph)SGSEGVPFR_
F2RL1 Ubiquitylation K368 0.159 0.737 _TVK(gl)QMQVSLTSK_
F2RL1 Ubiquitylation K377 -0.040 -0.268 _QMQVSLTSK(gl)K_
F2RL1 Ubiquitylation K378 0.066 -0.268 _QMQVSLTSKK(gl)_
F2RL1 Phosphorylation S384 0.573 1.068 _KSS(ph)SYSSSSTTVK_
F2RL1 Ubiquitylation K394 0.350 0.873 _KSSSYSSSSTTVK(gl)TSY_
JUN Phosphorylation S58 -0.167 -1.247 _AKNS(ph)DLLTSPDVGLLK_
JUN Phosphorylation T62 2.545 1.674 _NSDLLT(ph)SPDVGLLK_
JUN Phosphorylation S63 2.030 1.458 _NSDLLTS(ph)PDVGLLK_
JUN Ubiquitylation K70 9.213 _NSDLLTSPDVGLLK(gl)_
JUN Phosphorylation S73 1.499 0.845 _LAS(ph)PELER_
JUN Phosphorylation S243 -0.642 -1.399 _LQALKEEPQTVPEMPGETPPLS(ph)PIDMESQER_
JUN Ubiquitylation K309 1.034 0.155 _EQVAQLK(gl)QK_
MYEF2 Phosphorylation T13 -1.184 -1.261 _(ac)ADANKAEVPGAT(ph)GGDSPHLQPAEPPGEPR_
MYEF2 Phosphorylation S17 -1.239 -1.089 _AEVPGATGGDS(ph)PHLQPAEPPGEPR_
MYEF2 Ubiquitylation K117 0.042 _WQAIK(gl)DLMR_
MYEF2 Ubiquitylation K521 0.604 _IGSK(gl)GNQIFVR_
PLD1 Ubiquitylation K501 -0.155 _LTDVGSVK(gl)R_
PLD1 Ubiquitylation K547 0.453 1.120 _SIDDVDSK(gl)LK_
PLD1 Ubiquitylation K549 1.120 _SIDDVDSK(gl)LK_
PLD1 Ubiquitylation K1000 -0.600 _NATIYDK(gl)VFR_
PLD2 Ubiquitylation K80 2.298 _YTSGSK(gl)VGTCTLYSVR_
PLD3 Ubiquitylation K4 -1.907 _M(ox)KPK(gl)LM(ox)YQELK_
RAF1 Phosphorylation S29 0.028 -0.571 _DAVFDGSSCIS(ph)PTIVQQFGYQR_
RAF1 Phosphorylation T31 0.028 -0.669 _DAVFDGSSCIS(ph)PTIVQQFGYQR_
RAF1 Phosphorylation S244 0.053 _YSTPHAFTFNTSS(ph)PSSEGSLSQR_
RAF1 Phosphorylation S259 -0.069 0.054 _STS(ph)TPNVHM(ox)VSTTLPVDSR_
RAF1 Phosphorylation S301 -0.651 _SHSESASPSALSSSPNNLS(ph)PTGWSQPK_
RAF1 Phosphorylation T303 -0.664 _SHSESASPSALSSSPNNLSPT(ph)GWSQPK_
RAF1 Phosphorylation S497 -0.449 _SRWS(ph)GSQQVEQPTGSVLWMAPEVIR_
RAF1 Phosphorylation S621 0.212 0.271 _SAS(ph)EPSLHR_
RAF1 Phosphorylation S642 -0.197 0.463 _AAHTEDINACTLTTS(ph)PR_
SRC Phosphorylation S17 -0.604 -0.689 _S(ph)LEPAENVHGAGGGAFPASQTPSKPASADGHR_
SRC Phosphorylation S75 0.060 0.331 _LFGGFNSSDTVTS(ph)PQR_


© Copyright Svejstrup Laboratory 2015