bioLOGIC Data » bioLOGIC CategoryView » bioLOGIC VennView » Experimental Details »
bioLOGIC Category

Results for the Category
social behavior
(GO:0035176)

RNAi screen result RNAPII IP (MG132) CSB IP CSB IP (MG132) Chrom. Chrom. (MG132) Ubi /Phospo Ubi /Phospho (MG132)
W

Protein Results:

Results for post-translational modifications (below)
Gene name MGoogle Score RNAi high RNAi low RNAPII-IP (MG132) CSB-IP CSB-IP (MG132) Chrom. Chrom. (MG132)
VPS13A 2 -2.100 4.280 0.799 -0.026
DLG4 1 -0.020 0.320 1.552 0.102 0.488
KRAS 1 -0.510 0.620 1.031 0.887
KRAS 1 -0.510 0.620 0.246 -0.346
ANXA7 1 -1.410 3.550 0.673 0.422 -0.159
HTT 1 -0.200 -0.360 0.632 0.847 0.550
MAPK8IP2 0 1.730 -1.220
PPP3CB 0 -1.240 2.140 -0.298 1.130
PPP3CB 0 -1.240 2.140 0.923 0.537
HRAS 0 1.470 -0.520
GNB1L 0 0.540 -0.860
DNAJC9 0 -0.940 0.650 -0.441 0.014

PTM Sites:

Back to Protein Results
Gene name PTM type PTM site UV UV (MG132) Sequence
ANXA7 Ubiquitylation K199 0.347 _AMK(gl)GFGTDEQAIVDVVANR_
ANXA7 Ubiquitylation K430 0.263 0.610 _LYYAMK(gl)GAGTDDSTLVR_
DLG4 Phosphorylation S102 -1.455 _SKPSEPIQPVNTWEISSLPSSTVTSETLPSSLS(ph)PSVEK_
DLG4 Phosphorylation T115 -0.707 -1.378 _YQDEDT(ph)PPQEHISPQITNEVIGPELVHVSEK_
DLG4 Phosphorylation S122 -1.073 _YQDEDTPPQEHIS(ph)PQITNEVIGPELVHVSEK_
DLG4 Phosphorylation S158 0.773 _NLSEIENVHGFVSHSHIS(ph)PIK_
DLG4 Ubiquitylation K321 1.264 1.435 _IMEIK(gl)LIK_
DLG4 Ubiquitylation K361 0.180 _IIEGGAAHK(gl)DGK_
DLG4 Ubiquitylation K452 -0.704 _YSPVSK(gl)AVLGDDEITREPR_
DLG4 Ubiquitylation K556 0.105 _FEAK(gl)IHDLR_
DLG4 Phosphorylation S573 0.697 _EQM(ox)M(ox)NSSISSGS(ph)GSLR_
DLG4 Phosphorylation S575 0.255 0.729 _EQMMNSSISSGSGS(ph)LR_
DLG4 Ubiquitylation K843 1.259 _SMENIMEMNK(gl)R_
DNAJC9 Phosphorylation S109 1.143 _KIS(ph)LEDIQAFEK_
GNB1L Ubiquitylation K155 -0.889 _TSVCALK(gl)PK_
HRAS Ubiquitylation K170 -1.005 _K(gl)LNPPDESGPGCMSCK_
HTT Ubiquitylation K260 -0.128 _AFIANLK(gl)_
HTT Phosphorylation S419 0.595 0.531 _SGS(ph)IVELIAGGGSSCS(ph)PVLSR_
HTT Phosphorylation S430 0.402 0.494 _SGSIVELIAGGGSS(ph)CSPVLSR_
HTT Phosphorylation S432 0.317 0.640 _SGSIVELIAGGGSSCS(ph)PVLSR_
HTT Phosphorylation S1195 -0.222 0.264 _EKEPGEQAS(ph)VPLSPK_
HTT Phosphorylation S1199 -0.456 -0.970 _GKEKEPGEQASVPLS(ph)PK_
HTT Ubiquitylation K1402 0.169 -0.538 _VSTQLK(gl)TNLTSVTK_
HTT Phosphorylation S1874 1.994 1.028 _LLSPQMS(ph)GEEEDSDLAAK_
KRAS Ubiquitylation K128 1.528 1.433 _TVDTK(gl)QAHELAK_
KRAS Ubiquitylation K235 0.591 0.087 _TVDTK(gl)QAQDLAR_
KRAS Ubiquitylation K254 -0.450 -0.156 _SYGIPFIETSAK(gl)TR_
MAPK8IP2 Ubiquitylation K674 -0.899 0.671 _DLLGSK(gl)R_
PPP3CB Ubiquitylation K32 -0.137 _LTAK(gl)EVFDNDGKPR_
PPP3CB Ubiquitylation K56 0.132 _VDVLK(gl)NHLVK_
PPP3CB Ubiquitylation K323 0.705 _AAVLK(gl)YENNVMNIR_
PPP3CB Ubiquitylation K405 0.078 _AIGK(gl)MAR_
VPS13A Ubiquitylation K1748 -1.291 _TVPMLLAK(gl)SR_
VPS13A Ubiquitylation K1825 -0.339 _MAIVESDPEEENYK(gl)VPEYK_
VPS13A Ubiquitylation K2228 1.347 1.510 _MLQYK(gl)ADGIHR_
VPS13A Ubiquitylation K2930 0.903 _ITGAMAK(gl)GVAAMTMDEDYQQK_
VPS13A Ubiquitylation K2944 1.033 0.232 _GVAAMTMDEDYQQK(gl)R_
VPS13A Ubiquitylation K2951 0.490 _EAMNK(gl)QPAGFR_
VPS13A Ubiquitylation K2988 0.895 _GAQK(gl)GGAAGFFK_
VPS13A Ubiquitylation K3152 0.349 _IINFK(gl)TPEDAR_


© Copyright Svejstrup Laboratory 2015