bioLOGIC Data » bioLOGIC CategoryView » bioLOGIC VennView » Experimental Details »
bioLOGIC Category

Results for the Category
ST_MYOCYTE_AD_PATHWAY
(Pathway_735)

RNAi screen result RNAPII IP (MG132) CSB IP CSB IP (MG132) Chrom. Chrom. (MG132) Ubi /Phospo Ubi /Phospho (MG132)
W

Protein Results:

Results for post-translational modifications (below)
Gene name MGoogle Score RNAi high RNAi low RNAPII-IP (MG132) CSB-IP CSB-IP (MG132) Chrom. Chrom. (MG132)
ITPR3 2 -0.190 -0.500 1.489 1.835
ITPR1 2 -0.040 0.000 1.489 1.835
ITPR1 2 -0.040 0.000 0.768 0.643
DLG4 1 -0.020 0.320 1.552 0.102 0.488
KAT5 1 3.690 -1.200
ASAH1 0 -0.300 0.340
ITPR2 0 -1.020 0.610 0.952 0.981
GNAI1 0 -0.580 0.990 0.116 -0.747
EPHB2 0 -0.630 0.780 0.221
EPHB2 0 -0.630 0.780
RAC1 0 -0.580 1.580 0.486 -0.364 -0.568
AKT1 0 -0.050 0.700
AKT1 0 0.860 -0.040
GNAQ 0 0.140 -0.310 0.052 0.449
DAG1 0 0.210 -0.400
CFB 0 -0.380 -0.210

PTM Sites:

Back to Protein Results
Gene name PTM type PTM site UV UV (MG132) Sequence
AKT1 Phosphorylation S124 0.252 0.311 _SGS(ph)PSDNSGAEEMEVSLAKPK_
AKT1 Phosphorylation S126 -0.241 _SGSPS(ph)DNSGAEEM(ox)EVSLAK_
AKT1 Ubiquitylation K301 0.988 _EGIK(gl)DGATMK_
ASAH1 Ubiquitylation K461 0.139 _ESLDVYELDAK(gl)QGR_
CFB Ubiquitylation K808 -6.292 _VASYGVK(gl)PR_
DAG1 Ubiquitylation K793 0.843 _LTLEDQATFIK(gl)K_
DAG1 Ubiquitylation K794 0.899 _LTLEDQATFIKK(gl)_
DAG1 Ubiquitylation K881 -0.342 _GSRPK(gl)NMTPYR_
DLG4 Phosphorylation S102 -1.455 _SKPSEPIQPVNTWEISSLPSSTVTSETLPSSLS(ph)PSVEK_
DLG4 Phosphorylation T115 -0.707 -1.378 _YQDEDT(ph)PPQEHISPQITNEVIGPELVHVSEK_
DLG4 Phosphorylation S122 -1.073 _YQDEDTPPQEHIS(ph)PQITNEVIGPELVHVSEK_
DLG4 Phosphorylation S158 0.773 _NLSEIENVHGFVSHSHIS(ph)PIK_
DLG4 Ubiquitylation K321 1.264 1.435 _IMEIK(gl)LIK_
DLG4 Ubiquitylation K361 0.180 _IIEGGAAHK(gl)DGK_
DLG4 Ubiquitylation K452 -0.704 _YSPVSK(gl)AVLGDDEITREPR_
DLG4 Ubiquitylation K556 0.105 _FEAK(gl)IHDLR_
DLG4 Phosphorylation S573 0.697 _EQM(ox)M(ox)NSSISSGS(ph)GSLR_
DLG4 Phosphorylation S575 0.255 0.729 _EQMMNSSISSGSGS(ph)LR_
DLG4 Ubiquitylation K843 1.259 _SMENIMEMNK(gl)R_
EPHB2 Ubiquitylation K578 -0.752 -0.618 _QSPEDVYFSK(gl)SEQLKPLK_
EPHB2 Ubiquitylation K583 0.445 0.124 _SEQLK(gl)PLK_
EPHB2 Ubiquitylation K617 0.339 _QK(gl)VIGAGEFGEVYK_
EPHB2 Ubiquitylation K649 -1.219 _TLK(gl)AGYTEK_
EPHB2 Phosphorylation S776 -0.147 -0.171 _FLEDDTS(ph)DPTYTSALGGK_
EPHB2 Phosphorylation S897 0.000 _LPS(ph)TSGSEGVPFR_
EPHB2 Phosphorylation T898 -0.329 0.424 _LPST(ph)SGSEGVPFR_
GNAI1 Ubiquitylation K92 0.873 0.567 _LK(gl)IDFGDSAR_
GNAQ Ubiquitylation K16 0.245 _TLESIMACCLSEEAK(gl)EAR_
GNAQ Ubiquitylation K102 -0.299 _IPYK(gl)YEHNK_
ITPR1 Ubiquitylation K529 1.377 _EK(gl)GGEGPLVR_
ITPR1 Phosphorylation S934 0.318 -0.802 _KQS(ph)VFSAPSLSAGASAAEPLDR_
ITPR1 Phosphorylation S937 -0.026 _KQSVFS(ph)APSLSAGASAAEPLDR_
ITPR1 Ubiquitylation K1534 -0.220 _TLAMVAK(gl)GR_
ITPR1 Phosphorylation S1598 1.165 0.362 _RDS(ph)VLAASR_
ITPR1 Phosphorylation S1832 0.650 0.560 _VAS(ph)FSIPGSSSR_
ITPR1 Ubiquitylation K2597 -0.819 _NK(gl)NLDWFPR_
ITPR1 Ubiquitylation K2628 -0.010 _ILQDK(gl)LNSTMK_
ITPR1 Phosphorylation S2670 1.132 1.555 _LGFVDVQNCIS(ph)R_
ITPR2 Ubiquitylation K909 -0.247 _LSK(gl)FQDGGNNVMR_
ITPR2 Phosphorylation S1160 0.443 0.895 _GGEEPIEESNILS(ph)PVQDGTK_
ITPR3 Ubiquitylation K529 1.377 _EK(gl)GGEGPLVR_
ITPR3 Phosphorylation S934 0.318 -0.802 _KQS(ph)VFSAPSLSAGASAAEPLDR_
ITPR3 Phosphorylation S937 -0.026 _KQSVFS(ph)APSLSAGASAAEPLDR_
ITPR3 Ubiquitylation K1534 -0.220 _TLAMVAK(gl)GR_
ITPR3 Phosphorylation S1832 0.650 0.560 _VAS(ph)FSIPGSSSR_
ITPR3 Ubiquitylation K2597 -0.819 _NK(gl)NLDWFPR_
ITPR3 Ubiquitylation K2628 -0.010 _ILQDK(gl)LNSTMK_
ITPR3 Phosphorylation S2670 1.132 1.555 _LGFVDVQNCIS(ph)R_
KAT5 Ubiquitylation K230 -0.079 _MK(gl)NIECIELGR_
KAT5 Ubiquitylation K274 -0.149 _SLK(gl)CLQR_
RAC1 Ubiquitylation K115 -1.745 -0.215 _AK(gl)WYPEVR_
RAC1 Ubiquitylation K142 0.492 _LDLRDDK(gl)DTIEK_
RAC1 Ubiquitylation K152 0.099 -0.292 _K(gl)LTPITYPQGLAMAK_
RAC1 Ubiquitylation K166 -0.981 -0.655 _LTPITYPQGLAMAK(gl)EIGAVK_
RAC1 Ubiquitylation K172 1.026 0.412 _EIGAVK(gl)YLECSALTQR_
RAC1 Ubiquitylation K185 -0.113 0.578 _GLK(gl)TVFDEAIR_
RAC1 Ubiquitylation K202 -1.379 -1.447 _AVLCPPPVK(gl)KR_
RAC1 Ubiquitylation K203 -1.708 -1.447 _AVLCPPPVKK(gl)_


© Copyright Svejstrup Laboratory 2015