bioLOGIC Data » bioLOGIC CategoryView » bioLOGIC VennView » Experimental Details »
bioLOGIC Category

Results for the Category
BIOCARTA_NOS1_PATHWAY
(Pathway_421)

RNAi screen result RNAPII IP (MG132) CSB IP CSB IP (MG132) Chrom. Chrom. (MG132) Ubi /Phospo Ubi /Phospho (MG132)
W

Protein Results:

Results for post-translational modifications (below)
Gene name MGoogle Score RNAi high RNAi low RNAPII-IP (MG132) CSB-IP CSB-IP (MG132) Chrom. Chrom. (MG132)
PRKAR1A 1 -0.550 0.230
PRKAR1A 1 -0.550 0.230
DLG4 1 -0.020 0.320 1.552 0.102 0.488
CALM2 1 -0.690 0.700 1.911
CALM2 1 -0.690 0.700 0.877 -4.680
CALM3 1 -0.190 0.120 1.911
CALM3 1 -0.190 0.120 0.877 -4.680
PRKAR1B 1 0.660 -0.470
PRKAR1B 1 0.660 -0.470
CALM1 1 -0.440 0.360 1.911
CALM1 1 -0.440 0.360 0.877 -4.680
PRKAR2B 0 -0.290 0.380
PPP3CB 0 -1.240 2.140 -0.298 1.130
PPP3CB 0 -1.240 2.140 0.923 0.537
PRKAR2A 0 -0.530 1.080 0.026 -1.317 -0.866 0.783 0.007
PRKAR2A 0 -0.530 1.080
PPP3CC 0 -0.380 1.050 -0.298 1.130
PPP3CC 0 -0.380 1.050 0.923 0.537
PPP3CA 0 1.550 -1.230 -0.298 1.130
PPP3CA 0 1.550 -1.230 0.923 0.537
PRKACB 0 1.740 -1.200 -1.064
PRKACB 0 1.740 -1.200 -1.005 -0.697 0.234 0.487
PRKCA 0 0.750 -0.690 0.349 0.585
PRKCA 0 0.750 -0.690
PRKCB 0 0.260 -0.530
PRKCB 0 0.260 -0.530 0.349 0.585

PTM Sites:

Back to Protein Results
Gene name PTM type PTM site UV UV (MG132) Sequence
CALM1 Ubiquitylation K78 0.061 _DGDGTITTK(gl)ELGTVMR_
CALM1 Ubiquitylation K142 0.922 _VFDK(gl)DGNGYISAAELR_
CALM2 Ubiquitylation K78 0.061 _DGDGTITTK(gl)ELGTVMR_
CALM2 Ubiquitylation K142 0.922 _VFDK(gl)DGNGYISAAELR_
CALM3 Ubiquitylation K78 0.061 _DGDGTITTK(gl)ELGTVMR_
CALM3 Ubiquitylation K142 0.922 _VFDK(gl)DGNGYISAAELR_
DLG4 Phosphorylation S102 -1.455 _SKPSEPIQPVNTWEISSLPSSTVTSETLPSSLS(ph)PSVEK_
DLG4 Phosphorylation T115 -0.707 -1.378 _YQDEDT(ph)PPQEHISPQITNEVIGPELVHVSEK_
DLG4 Phosphorylation S122 -1.073 _YQDEDTPPQEHIS(ph)PQITNEVIGPELVHVSEK_
DLG4 Phosphorylation S158 0.773 _NLSEIENVHGFVSHSHIS(ph)PIK_
DLG4 Ubiquitylation K321 1.264 1.435 _IMEIK(gl)LIK_
DLG4 Ubiquitylation K361 0.180 _IIEGGAAHK(gl)DGK_
DLG4 Ubiquitylation K452 -0.704 _YSPVSK(gl)AVLGDDEITREPR_
DLG4 Ubiquitylation K556 0.105 _FEAK(gl)IHDLR_
DLG4 Phosphorylation S573 0.697 _EQM(ox)M(ox)NSSISSGS(ph)GSLR_
DLG4 Phosphorylation S575 0.255 0.729 _EQMMNSSISSGSGS(ph)LR_
DLG4 Ubiquitylation K843 1.259 _SMENIMEMNK(gl)R_
PPP3CA Ubiquitylation K32 -0.137 _LTAK(gl)EVFDNDGKPR_
PPP3CA Ubiquitylation K56 0.132 _VDVLK(gl)NHLVK_
PPP3CA Ubiquitylation K323 0.705 _AAVLK(gl)YENNVMNIR_
PPP3CA Ubiquitylation K405 0.078 _AIGK(gl)MAR_
PPP3CB Ubiquitylation K32 -0.137 _LTAK(gl)EVFDNDGKPR_
PPP3CB Ubiquitylation K56 0.132 _VDVLK(gl)NHLVK_
PPP3CB Ubiquitylation K323 0.705 _AAVLK(gl)YENNVMNIR_
PPP3CB Ubiquitylation K405 0.078 _AIGK(gl)MAR_
PPP3CC Ubiquitylation K32 -0.137 _LTAK(gl)EVFDNDGKPR_
PPP3CC Ubiquitylation K56 0.132 _VDVLK(gl)NHLVK_
PPP3CC Ubiquitylation K323 0.705 _AAVLK(gl)YENNVMNIR_
PPP3CC Ubiquitylation K405 0.078 _AIGK(gl)MAR_
PRKACB Ubiquitylation K30 -0.143 _AKEDFLKK(gl)_
PRKACB Ubiquitylation K93 0.839 0.714 _QIEHTLNEK(gl)R_
PRKACB Phosphorylation T243 -0.835 _T(ph)WTLCGTPEYLAPEIILSK_
PRKACB Phosphorylation T245 -0.116 -0.102 _TWT(ph)LCGTPEYLAPEIILSK_
PRKAR1A Ubiquitylation K63 -1.895 _LEKEEAK(gl)QIQNLQK_
PRKAR1A Ubiquitylation K70 -0.869 0.073 _QIQNLQK(gl)AGTR_
PRKAR1A Phosphorylation S83 -0.969 -0.776 _EDEIS(ph)PPPPNPVVK_
PRKAR1A Ubiquitylation K92 -3.269 -2.395 _TDSREDEISPPPPNPVVK(gl)GR_
PRKAR1A Ubiquitylation K222 0.412 0.536 _TNVK(gl)LWGIDR_
PRKAR1A Ubiquitylation K244 -0.384 3.721 _K(gl)MYEEFLSK_
PRKAR1A Ubiquitylation K261 -0.886 _VSILESLDK(gl)WER_
PRKAR1A Ubiquitylation K346 0.329 _GPLK(gl)CVK_
PRKAR1A Ubiquitylation K349 -0.425 -0.103 _CVK(gl)LDRPR_
PRKAR1A Ubiquitylation K367 -0.939 0.044 _VLGPCSDILK(gl)R_
PRKAR1B Phosphorylation S3 0.185 0.343 _(ac)AS(ph)PPACPSEEDESLKGCELYVQLHGIQQVLK_
PRKAR1B Ubiquitylation K244 -0.384 3.721 _K(gl)MYEEFLSK_
PRKAR1B Ubiquitylation K346 0.329 _GPLK(gl)CVK_
PRKAR1B Ubiquitylation K349 -0.425 -0.103 _CVK(gl)LDRPR_
PRKAR2A Phosphorylation S99 0.020 0.056 _RVS(ph)VCAETYNPDEEEEDTDPR_
PRKAR2A Phosphorylation T104 -0.175 _RVSVCAET(ph)YNPDEEEEDTDPR_
PRKAR2A Ubiquitylation K359 0.640 _GQYFGELALVTNK(gl)PR_
PRKAR2B Phosphorylation T69 -0.367 _TWGDLGAAAGGGT(ph)PSK_
PRKAR2B Phosphorylation S114 0.366 0.525 _RAS(ph)VCAEAYNPDEEEDDAESR_
PRKAR2B Ubiquitylation K359 0.640 _GQYFGELALVTNK(gl)PR_
PRKCA Phosphorylation S10 -0.650 0.036 _(ac)ADVFPGNDS(ph)TASQDVANR_
PRKCA Phosphorylation S13 -1.038 0.335 _(ac)ADVFPGNDSTAS(ph)QDVANR_
PRKCA Phosphorylation S226 0.693 0.415 _STLNPQWNES(ph)FTFK_
PRKCA Ubiquitylation K316 -0.522 -0.535 _LGPAGNK(gl)VISPSEDR_
PRKCB Phosphorylation S10 -0.650 0.036 _(ac)ADVFPGNDS(ph)TASQDVANR_
PRKCB Phosphorylation S13 -1.038 0.335 _(ac)ADVFPGNDSTAS(ph)QDVANR_
PRKCB Phosphorylation S226 0.693 0.415 _STLNPQWNES(ph)FTFK_
PRKCB Ubiquitylation K315 0.213 0.518 _ISQGTK(gl)VPEEK_


© Copyright Svejstrup Laboratory 2015