bioLOGIC Data » bioLOGIC CategoryView » bioLOGIC VennView » Experimental Details »

bioLOGIC Category

Results for the Category
chromatin
(GO:0000785)

RNAi screen result RNAPII IP (MG132) CSB IP CSB IP (MG132) Chrom. Chrom. (MG132) Ubi /Phospo Ubi /Phospho (MG132)
W

Protein Results:

 Results for post-translational modifications (below)
Gene name MGoogle Score RNAi high RNAi low RNAPII-IP (MG132) CSB-IP CSB-IP (MG132) Chrom. Chrom. (MG132)
TRIM28 4 -0.250 -0.030 -0.451 -1.012 0.467 -0.209 -0.279
TRIM28 4 -0.250 -0.030
SMC3 3 -0.960 1.470
SMC3 3 -0.960 1.470 0.213 0.283
SMC3 3 -0.960 1.470 2.266 0.833 0.442
TMPO 3 -1.220 1.690 -0.946 1.359 0.557 -0.392 -0.253
TMPO 3 -1.220 1.690 -0.315 -0.601 -0.208 0.507 0.452
RAD18 2 0.290 -0.170
RAD18 2 0.290 -0.170 0.133 -0.034 0.651
RAD18 2 0.290 -0.170 -0.119
MCM2 2 0.740 -0.140 0.552 0.052
MCM2 2 0.740 -0.140 1.288
MCM2 2 0.740 -0.140
HMGA1 2 -0.300 0.610 -1.084 -0.264
HMGA1 2 -0.300 0.610
CHEK1 2 -1.170 1.560
CHEK1 2 -1.170 1.560
H2AFX 2 -0.474 -0.395 0.182 0.824 0.499
H2AFX 2
HMGN1 2 -0.050 0.130
HMGN1 2 -0.050 0.130
TOX4 1 0.430 -0.290 -0.273 1.371 1.804 -2.005 0.037
SNW1 1 -2.350 4.480
SNW1 1 -2.350 4.480 -0.520 -1.264 -0.234 -2.391 -0.788
EIF3E 1 0.730 -0.450 0.344 0.334
EIF3E 1 0.730 -0.450 1.131 -0.262 -0.898
CBX1 1 -2.050 3.860 -0.630 0.171 1.328 1.100
CENPF 1 -1.080 2.380 -0.412 -0.373
HMGN3 1 0.310 -0.590 -1.537 -1.454
CCND2 1 1.210 -0.610
PDS5A 1 0.590 -0.570 -0.833 0.206 0.212 0.449 0.249
MED1 1 0.780 -0.520 -1.530 -0.219
JUND 1 0.270 0.190
RAN 1 0.795 0.949 -0.688 0.566 0.288
HLCS 1 -1.940 3.470
WDR82 1 -1.220 1.640 -0.017 1.342 1.794 0.081 0.046
RCOR2 1 1.220 -0.890 0.549
RCOR2 1 1.220 -0.890 0.185 -0.123 0.523 0.896 0.794
KAT5 1 3.690 -1.200
HMGN4 1 0.590 -0.830
NCOR2 1 1.850 -1.050
NCOR2 1 1.850 -1.050 0.037 -1.127
HDAC2 1 -2.390 4.970
HDAC2 1 -2.390 4.970 0.187 -0.007 0.825
HMGN2 1 0.150 0.730
HMGN2 1 0.150 0.730 -1.537 -1.454
UPF1 0 -0.362 -0.954 -0.781 -0.966 -0.333
UBR2 0 -0.250 0.600 -1.757
WAPAL 0 -0.050 1.110 -0.551 0.359 0.266 -0.378 0.010
NEDD4 0 -1.320 1.730
MBD3 0 0.730 -1.260 0.210 0.189 0.976 0.079 0.453
KIF22 0 -0.380 0.440 -2.282 -0.477 0.069 -0.172 0.159
PDS5B 0 0.400 -0.180 0.010 0.455 1.005 0.576
SIRT1 0 0.910 -0.910
EP300 0 -1.210 1.320 -1.089 -1.694 -0.723
POLA1 0 0.720 -0.610 0.594 0.355 0.027
STAG2 0 0.690 -0.320 1.092 0.608
STAG2 0 0.690 -0.320
STAG2 0 0.690 -0.320 0.933 0.143 0.415
OIP5 0 0.280 0.160
ASF1B 0 -0.590 0.490
ID2 0 -0.080 -0.630
ORC2 0 -1.110 1.470 -0.064 0.370 -0.139 -0.210
NFE2L2 0 1.610 -1.200
STAG1 0 0.770 -0.270 0.181 -0.065 0.529
STAG1 0 0.770 -0.270
CBX3 0 0.390 0.010 -0.267 -0.513 0.225
MAU2 0 0.670 0.418
MAU2 0 0.221 1.190 0.643
MEN1 0 1.080 -1.150 0.101 0.684 -0.063
MEN1 0 1.080 -1.150 0.395
MEN1 0 1.080 -1.150
MBD2 0 -1.430 2.250 0.312 1.033
CDK4 0 1.930 -0.950
CDK4 0 1.930 -0.950 -0.510 0.013
ARRB1 0 0.960 -0.620
RB1 0 1.180 -1.070 0.429 0.755
RB1 0 1.180 -1.070
ESCO1 0 0.210 -0.700 -0.254
TP53 0 -1.070 1.050 -2.808 0.076 -0.094 0.436 0.497
MBD1 0 0.490 -0.120 -0.298
HMGA2 0 0.340 -0.490
SUV39H2 0 -0.980 2.320 1.259 0.440
AHCTF1 0 -0.530 0.010 0.447 0.316
CAPN2 0 -1.140 1.400 0.314
CAPN2 0 -1.140 1.400 0.522 0.716 -0.611
T 0 0.200 -0.340 -0.755
MCM7 0 -0.260 -0.010 0.361 -0.040
MCM7 0 -0.260 -0.010 0.592
SIN3A 0 -0.610 0.780 0.378 -0.208 0.304 -0.168 0.410
JUNB 0 0.350 -0.410
ESCO2 0 -0.180 0.190
SATB1 0 1.140 -1.300 -0.866 0.000
PARPBP 0 0.040 0.000
HMGN5 0 0.120 -0.720 -1.319 -0.947

PTM Sites:

 Back to Protein Results
Gene name PTM type PTM site UV UV (MG132) Sequence
AHCTF1 Phosphorylation S1160 0.346 0.516 _SLPSSSQLKGS(ph)PQAISR_
AHCTF1 Phosphorylation S1216 -0.315 _STPLASPS(ph)PSPGRSPQR_
AHCTF1 Phosphorylation S1218 -0.804 _STPLASPSPS(ph)PGRSPQR_
AHCTF1 Phosphorylation S1222 -1.411 -0.552 _STPLASPSPSPGRS(ph)PQR_
AHCTF1 Phosphorylation S1283 1.167 _TTSFFLNS(ph)PEKEHQEMDEGSQSLEK_
AHCTF1 Phosphorylation S1541 0.225 0.046 _NLS(ph)FNELYPSGTLK_
AHCTF1 Phosphorylation S1944 0.155 0.289 _EVS(ph)PSDVR_
ARRB1 Phosphorylation S412 0.138 0.253 _GMKDDKEEEEDGTGS(ph)PQLNNR_
ASF1B Ubiquitylation K129 -1.048 -1.953 _ENPPMK(gl)PDFSQLQR_
ASF1B Phosphorylation T179 0.018 _LEAIETQDPSLGCGLPLNCT(ph)PIK_
CBX1 Ubiquitylation K35 0.698 _GK(gl)VEYLLK_
CBX1 Phosphorylation S89 0.056 0.422 _ADS(ph)DSEDKGEESKPK_
CBX1 Ubiquitylation K139 -0.287 _WK(gl)NSDEADLVPAK_
CBX1 Ubiquitylation K150 0.289 -0.097 _NSDEADLVPAK(gl)EANVK_
CBX3 Ubiquitylation K5 0.311 0.641 _(ac)ASNK(gl)TTLQK_
CBX3 Ubiquitylation K44 0.789 _VVNGK(gl)VEYFLK_
CBX3 Phosphorylation S93 0.091 0.587 _RKS(ph)LSDSESDDSK_
CBX3 Ubiquitylation K143 0.274 _WK(gl)DSDEADLVLAK_
CBX3 Ubiquitylation K154 0.457 -0.090 _WKDSDEADLVLAK(gl)EANMK_
CCND2 Ubiquitylation K45 -0.759 -0.277 _YLPQCSYFK(gl)CVQK_
CCND2 Ubiquitylation K49 -0.524 _CVQK(gl)DIQPYMR_
CCND2 Ubiquitylation K113 -0.572 _LK(gl)ETSPLTAEK_
CCND2 Ubiquitylation K173 -1.137 0.202 _EK(gl)LSLIR_
CCND2 Phosphorylation S269 0.049 _DGS(ph)KSEDELDQASTPTDVR_
CCND2 Phosphorylation S271 2.155 _DGSKS(ph)EDELDQASTPTDVR_
CDK4 Ubiquitylation K142 -0.552 _DLK(gl)PENILVTSGGTVK_
CDK4 Ubiquitylation K211 -0.101 _K(gl)PLFCGNSEADQLGK_
CDK4 Phosphorylation S236 0.095 _QDDS(ph)PSGASYGQDYDLS(ph)PSR_
CDK4 Phosphorylation S249 0.095 _QDDS(ph)PSGASYGQDYDLS(ph)PSR_
CDK4 Ubiquitylation K297 0.247 0.052 _ALQHSYLHK(gl)DEGNPE_
CDK4 Phosphorylation S385 0.649 _HSSIS(ph)PVRLPLNSSLGAELSR_
CDK4 Phosphorylation S420 0.004 -0.202 _ES(ph)KGSPVFLPR_
CDK4 Phosphorylation S423 -0.155 -0.297 _GS(ph)PVFLPR_
CDK4 Phosphorylation T514 0.364 0.570 _DSKPIALKEEIVT(ph)PK_
CDK4 Phosphorylation S681 -2.532 -2.051 _HLLTDLPLPPELPGGDLS(ph)PPDS(ph)PEPK_
CDK4 Phosphorylation S685 -2.729 _HLLTDLPLPPELPGGDLS(ph)PPDS(ph)PEPK_
CDK4 Phosphorylation T692 -0.765 -1.849 _AIT(ph)PPQQPYK_
CDK4 Phosphorylation S1082 -1.661 -0.980 _KETTSGTSTEPVKNS(ph)SPAPPQPAPGK_
CDK4 Phosphorylation S1083 -1.093 -1.330 _NSS(ph)PAPPQPAPGK_
CDK4 Phosphorylation T1244 -0.956 _RT(ph)PTMPQEEAAACPPHILPPEK_
CENPF Ubiquitylation K263 0.419 -0.113 _STLQIGK(gl)R_
CENPF Phosphorylation S276 0.013 _RDANSSFFDNSSS(ph)PHLLDQLK_
CENPF Ubiquitylation K293 -0.460 _NK(gl)INELELR_
CENPF Ubiquitylation K326 -0.856 _FQELQLQLEKAK(gl)_
CENPF Ubiquitylation K513 -1.965 _NIK(gl)QCLNQSQNFAEEMK_
CENPF Ubiquitylation K555 -0.739 -0.237 _INQQENSLTLEK(gl)LK_
CENPF Ubiquitylation K606 0.112 _ALLSALELKK(gl)_
CENPF Ubiquitylation K657 -0.600 0.172 _TQQIK(gl)SHEYNER_
CENPF Ubiquitylation K689 -0.011 _NLHNVLDSK(gl)SVEVETQK_
CENPF Ubiquitylation K770 -1.636 -0.056 _SK(gl)DASLVTNEDHQR_
CENPF Ubiquitylation K823 -1.207 -0.686 _LEADQSPK(gl)NSAILQNR_
CENPF Phosphorylation S834 1.282 _VDS(ph)LEFSLESQK_
CENPF Ubiquitylation K1022 -0.770 _SISELSDQYKQEK(gl)_
CENPF Phosphorylation S1255 2.400 _GDLETSNLQDMQS(ph)QEISGLKDCEIDAEEK_
CENPF Phosphorylation S1747 -0.145 _LQLQGLDLS(ph)SR_
CENPF Phosphorylation S1750 -1.171 -0.117 _S(ph)LLGIDTEDAIQGR_
CENPF Phosphorylation T1825 -0.475 _ITETGAVKPTGECSGEQSPDT(ph)NYEPPGEDK_
CENPF Ubiquitylation K2069 -0.699 _GELDTMSKK(gl)_
CENPF Ubiquitylation K2713 0.058 _MTAK(gl)ETELQR_
CENPF Ubiquitylation K2739 -1.524 _TAELQEELSGEK(gl)NR_
CENPF Phosphorylation S2996 -1.047 -1.005 _GS(ph)PLLGPVVPGPS(ph)PIPSVTEK_
CENPF Phosphorylation S3007 -0.910 -2.059 _GS(ph)PLLGPVVPGPS(ph)PIPSVTEK_
CENPF Phosphorylation S3119 -0.975 -0.328 _LALS(ph)PLSLGK_
CENPF Phosphorylation S3150 1.391 1.078 _VAQRS(ph)PVDSGTILR_
CENPF Phosphorylation S3175 1.052 0.884 _SVPVNNLPERS(ph)PTDSPR_
CHEK1 Ubiquitylation K53 0.879 _AVDCPENIK(gl)K_
CHEK1 Ubiquitylation K54 0.738 _AVDCPENIKK(gl)_
CHEK1 Phosphorylation S296 -0.098 0.184 _VTS(ph)GGVSESPSGFSK_
CHEK1 Phosphorylation S300 1.091 _VTSGGVS(ph)ESPSGFSK_
CHEK1 Phosphorylation S302 1.750 _VTSGGVSES(ph)PSGFSK_
CHEK1 Phosphorylation S317 1.903 _HIQSNLDFS(ph)PVNSASSEENVK_
CHEK1 Ubiquitylation K399 -0.582 _ETCEK(gl)LGYQWK_
EIF3E Ubiquitylation K93 -1.262 _QLQAETEPIVK(gl)MFEDPETTR_
EIF3E Ubiquitylation K265 0.383 _YLTTAVITNK(gl)DVR_
EIF3E Ubiquitylation K275 0.354 _QVLK(gl)DLVK_
EIF3E Ubiquitylation K383 -0.383 0.200 _LDAK(gl)IDSK_
EIF3E Ubiquitylation K387 -1.539 _IDSK(gl)LGHVVMGNNAVSPYQQVIEK_
EIF3E Phosphorylation S399 0.511 -0.527 _LGHVVMGNNAVS(ph)PYQQVIEK_
EIF3E Ubiquitylation K409 0.985 2.077 _TK(gl)SLSFR_
EIF3E Ubiquitylation K424 -0.366 _SQMLAMNIEK(gl)K_
EIF3E Ubiquitylation K425 -0.382 0.649 _SQMLAMNIEKK(gl)_
EP300 Phosphorylation S1038 -0.672 -0.349 _TEIKEEEDQPSTSATQSS(ph)PAPGQSK_
EP300 Phosphorylation S1726 0.994 0.627 _LGLGLDDESNNQQAAATQS(ph)PGDSRR_
EP300 Phosphorylation S2328 -1.092 0.725 _PQSQPPHSSPS(ph)PR_
ESCO1 Ubiquitylation K406 1.156 0.878 _FNSVQHNK(gl)_
ESCO1 Phosphorylation S409 0.110 -0.056 _LDS(ph)QVSPK_
ESCO1 Phosphorylation S412 -0.068 _LDSQVS(ph)PK_
ESCO2 Phosphorylation S512 0.375 0.076 _VLSEPIGPES(ph)PSSTECPR_
H2AFX Ubiquitylation K116 -0.071 _ATIAGGGVIPHIHK(gl)SLIGK_
H2AFX Ubiquitylation K120 0.702 0.181 _K(gl)TSATVGPK_
H2AFX Ubiquitylation K121 1.548 0.818 _SLIGK(gl)K(gl)GQQK_
H2AFX Ubiquitylation K122 1.238 -0.400 _SLIGK(gl)K(gl)GQQK_
H2AFX Ubiquitylation K126 1.132 _KGQQK(gl)TV_
H2AFX Ubiquitylation K128 -0.411 0.117 _KTSATVGPK(gl)APSGGKK_
H2AFX Phosphorylation S140 1.817 1.205 _KATQAS(ph)QEY_
HDAC2 Ubiquitylation K50 0.036 _K(gl)MEIYRPHK_
HDAC2 Ubiquitylation K67 -0.467 _ATAEEMTK(gl)YHSDEYIK_
HDAC2 Ubiquitylation K89 0.749 -0.241 _SIRPDNMSEYSK(gl)QMQR_
HDAC2 Ubiquitylation K284 0.749 _GHAK(gl)CVEVVK_
HDAC2 Phosphorylation S394 -0.865 -0.997 _M(ox)LPHAPGVQM(ox)QAIPEDAVHEDS(ph)GDEDGEDPDKR_
HDAC2 Phosphorylation S422 0.482 0.781 _IACDEEFS(ph)DSEDEGEGGR_
HLCS Phosphorylation S124 -0.164 -0.488 _FAS(ph)AENIPDLPYDYSSSLESVADETSPER_
HLCS Phosphorylation S147 -0.852 -0.599 _FASAENIPDLPYDYSSSLESVADETS(ph)PER_
HMGA1 Phosphorylation S2 -0.266 1.155 _(ac)S(ph)ESSSKS(ph)SQPLASK_
HMGA1 Phosphorylation S4 0.519 _(ac)SES(ph)SSKS(ph)SQPLASK_
HMGA1 Phosphorylation S5 0.398 0.365 _(ac)SESS(ph)SKSSQPLASK_
HMGA1 Phosphorylation S6 0.475 0.368 _(ac)SESSS(ph)KSSQPLASK_
HMGA1 Ubiquitylation K7 0.088 0.752 _(ac)SESSSK(gl)SSQPLASK_
HMGA1 Phosphorylation S8 2.198 2.240 _(ac)SESSSKS(ph)SQPLASK_
HMGA1 Phosphorylation S9 1.976 2.155 _(ac)SESSSKSS(ph)QPLASK_
HMGA1 Ubiquitylation K15 0.114 -0.136 _SSQPLASK(gl)QEKDGTEK_
HMGA1 Ubiquitylation K18 0.073 -0.136 _SSQPLASKQEK(gl)_
HMGA1 Phosphorylation S36 -1.043 -0.690 _KQPPVS(ph)PGTALVGSQK_
HMGA1 Phosphorylation S44 -0.035 0.111 _KQPPVSPGTALVGS(ph)QKEPSEVPTPK_
HMGA1 Ubiquitylation K46 -1.742 _KQPPVSPGTALVGSQK(gl)EPSEVPTPK_
HMGA1 Phosphorylation S49 -2.923 0.166 _KQPPVSPGTALVGSQKEPS(ph)EVPTPK_
HMGA1 Phosphorylation T53 -2.612 -2.477 _KQPPVSPGTALVGSQKEPSEVPT(ph)PK_
HMGA1 Phosphorylation S102 -0.522 -0.117 _KLEKEEEEGISQES(ph)SEEEQ_
HMGA1 Phosphorylation S103 0.370 _EEEEGISQESS(ph)EEEQ_
HMGA2 Phosphorylation S44 -0.564 -0.762 _KQQQEPTGEPS(ph)PK_
HMGA2 Phosphorylation S105 -0.055 -0.046 _KPAQEETEETSSQES(ph)AEED_
HMGN1 Phosphorylation S7 1.696 0.085 _KVS(ph)SAEGAAKEEPK_
HMGN1 Phosphorylation S8 0.243 0.475 _VSS(ph)AEGAAKEEPK_
HMGN1 Ubiquitylation K30 1.557 _VSSAEGAAK(gl)EEPK_
HMGN1 Phosphorylation S86 0.276 0.310 _TEES(ph)PASDEAGEKEAK_
HMGN1 Phosphorylation S89 0.009 _TEESPAS(ph)DEAGEKEAK_
HMGN1 Phosphorylation S99 0.293 0.342 _TEESPASDEAGEKEAKS(ph)D_
HMGN2 Phosphorylation T10 -0.157 _RKSPENT(ph)EGK_
HMGN2 Ubiquitylation K31 -1.653 _LSAK(gl)PAPPKPEPKPK_
HMGN2 Phosphorylation S31 -1.777 -1.714 _LS(ph)AKPAPPKPEPK_
HMGN2 Ubiquitylation K33 -1.736 _LSAK(gl)PAPPKPEPKPR_
HMGN2 Ubiquitylation K36 -1.444 _LSAKPAPPK(gl)PEPKPK_
HMGN2 Ubiquitylation K76 0.560 1.312 _EGNNPAENGDAK(gl)TDQAQK_
HMGN2 Phosphorylation S78 3.475 _EGTAPS(ph)ENGETKAEEAQK_
HMGN2 Phosphorylation S93 0.325 0.602 _AEEAQKTES(ph)VDNEGE_
HMGN3 Phosphorylation T10 -0.157 _RKSPENT(ph)EGK_
HMGN3 Phosphorylation S31 -1.777 -1.714 _LS(ph)AKPAPPKPEPK_
HMGN3 Ubiquitylation K33 -1.736 _LSAK(gl)PAPPKPEPKPR_
HMGN3 Phosphorylation S78 3.475 _EGTAPS(ph)ENGETKAEEAQK_
HMGN3 Phosphorylation S93 0.325 0.602 _AEEAQKTES(ph)VDNEGE_
HMGN4 Phosphorylation S80 0.406 2.072 _DASTLQS(ph)QKAEGTGDAK_
ID2 Phosphorylation S14 -0.139 _NS(ph)LSDHSLGISR_
JUNB Phosphorylation T255 -0.205 _DAT(ph)PPVS(ph)PINMEDQER_
JUNB Phosphorylation S259 -0.205 _DAT(ph)PPVS(ph)PINMEDQER_
JUND Phosphorylation S90 2.088 1.448 _ADGAPSAAPPDGLLAS(ph)PDLGLLK_
JUND Phosphorylation S255 -1.629 -1.982 _LAALKDEPQTVPDVPSFGES(ph)PPLSPIDMDTQER_
JUND Phosphorylation S259 -0.855 _LAALKDEPQTVPDVPSFGESPPLS(ph)PIDMDTQER_
KAT5 Ubiquitylation K230 -0.079 _MK(gl)NIECIELGR_
KAT5 Ubiquitylation K274 -0.149 _SLK(gl)CLQR_
KIF22 Phosphorylation S412 -1.255 _GPEEEEIGS(ph)PEPMAAPASASQK_
KIF22 Phosphorylation S543 0.090 -0.848 _AVVMPLQLIQEQAAS(ph)PNAEIHILK_
MAU2 Ubiquitylation K315 0.514 0.335 _YTDK(gl)ALMQLEK_
MAU2 Ubiquitylation K322 0.244 -0.050 _ALMQLEK(gl)LK_
MBD1 Ubiquitylation K110 0.094 _AHPVAVASK(gl)K_
MBD1 Ubiquitylation K111 0.094 _AHPVAVASK(gl)K_
MBD1 Phosphorylation S362 -0.412 -0.135 _ALAPS(ph)PPAEFIYYCVDEDELQPYTNRR_
MBD1 Ubiquitylation K434 0.418 _QCLQFAMK(gl)R_
MBD1 Phosphorylation T621 -0.248 _LAPEEEAGGAGT(ph)PVITEIFSLGGTR_
MBD2 Ubiquitylation K185 0.919 _SDVYYFSPSGK(gl)K_
MBD3 Ubiquitylation K42 -0.711 _DVFYYSPSGKK(gl)_
MBD3 Phosphorylation S56 0.663 0.474 _YLGGS(ph)MDLSTFDFR_
MBD3 Phosphorylation S85 0.574 0.485 _VRYDS(ph)SNQVK_
MBD3 Ubiquitylation K92 -0.542 _GK(gl)PDLNTALPVR_
MBD3 Ubiquitylation K124 0.195 _ITNHPSNKVK(gl)_
MBD3 Ubiquitylation K129 -0.498 _SDPQK(gl)AVDQPR_
MCM2 Phosphorylation S4 0.060 -0.102 _(ac)AES(ph)SESFTM(ox)ASS(ph)PAQR_
MCM2 Phosphorylation S5 0.653 0.313 _(ac)AESS(ph)ESFTMASSPAQR_
MCM2 Phosphorylation T9 0.528 0.894 _(ac)AESSESFT(ph)MASSPAQR_
MCM2 Phosphorylation S12 0.027 0.508 _AESSESFTMAS(ph)SPAQR_
MCM2 Phosphorylation S13 0.595 0.841 _(ac)AESSESFTMASS(ph)PAQR_
MCM2 Phosphorylation S26 0.334 0.204 _GNDPLTS(ph)SPGR_
MCM2 Phosphorylation S27 0.076 0.378 _GNDPLTSS(ph)PGR_
MCM2 Phosphorylation S40 0.648 1.028 _TDALTS(ph)SPGR_
MCM2 Phosphorylation S41 0.613 0.869 _RTDALTSS(ph)PGR_
MCM2 Phosphorylation T106 2.035 2.162 _AIPELDAYEAEGLALDDEDVEELT(ph)ASQR_
MCM2 Phosphorylation S108 1.832 2.212 _AIPELDAYEAEGLALDDEDVEELTAS(ph)QR_
MCM2 Phosphorylation S139 0.404 0.482 _GLLYDS(ph)DEEDEERPAR_
MCM2 Ubiquitylation K205 0.225 0.747 _ISDMCK(gl)ENR_
MCM2 Ubiquitylation K365 -0.341 0.407 _IQESPGK(gl)VAAGR_
MCM2 Ubiquitylation K450 0.216 0.470 _MITSLSK(gl)DQQIGEK_
MCM2 Ubiquitylation K946 -0.032 _FSHDLK(gl)R_
MCM7 Ubiquitylation K4 -1.164 _(ac)ALK(gl)DYALEKEK_
MCM7 Ubiquitylation K10 -0.334 -1.453 _(ac)ALKDYALEK(gl)EK_
MCM7 Ubiquitylation K12 -1.492 _DYALEK(gl)EK_
MCM7 Ubiquitylation K28 -0.102 -0.861 _FLQEFYQDDELGK(gl)K_
MCM7 Ubiquitylation K29 -1.023 -0.094 _FLQEFYQDDELGKK(gl)QFK_
MCM7 Ubiquitylation K32 0.146 -0.970 _QFK(gl)YGNQLVR_
MCM7 Ubiquitylation K89 -1.906 -1.328 _LFADAVQELLPQYK(gl)ER_
MCM7 Phosphorylation S121 0.902 0.509 _S(ph)PQNQYPAELMR_
MCM7 Ubiquitylation K145 -2.703 _RFELYFQGPSSNK(gl)PR_
MCM7 Ubiquitylation K159 0.038 -0.495 _ADSVGK(gl)LVTVR_
MCM7 Ubiquitylation K231 -0.965 _FIK(gl)FQEMK_
MCM7 Ubiquitylation K236 -1.769 _FQEMK(gl)MQEHSDQVPVGNIPR_
MCM7 Ubiquitylation K352 -1.468 _LAASIAPEIYGHEDVKK(gl)_
MCM7 Ubiquitylation K557 -2.556 -2.098 _QPPSQFEPLDMK(gl)LMR_
MCM7 Ubiquitylation K596 -0.751 -0.539 _REAWASK(gl)DATYTSAR_
MCM7 Ubiquitylation K627 -0.965 -0.588 _MVDVVEK(gl)EDVNEAIR_
MCM7 Ubiquitylation K641 -0.836 -0.945 _LMEMSK(gl)DSLLGDKGQTAR_
MCM7 Ubiquitylation K648 -0.422 -0.441 _DSLLGDK(gl)GQTAR_
MED1 Phosphorylation S664 3.368 _DNPAQDFSTLYGSS(ph)PLER_
MED1 Phosphorylation S771 -1.422 _LSS(ph)SDSIGPDVTDILSDIAEEASKLPSTSDDCPAIGTPLR_
MED1 Phosphorylation T1051 -1.201 -1.247 _SQT(ph)PPGVATPPIPK_
MED1 Phosphorylation T1057 -1.294 _SQT(ph)PPGVAT(ph)PPIPK_
MED1 Phosphorylation S1155 0.689 _NSSQSGGKPGS(ph)SPITK_
MED1 Phosphorylation S1156 0.829 1.055 _NSSQSGGKPGSS(ph)PITK_
MED1 Phosphorylation S1192 -0.792 _PSSLM(ox)NPSLSKPNIS(ph)PSHSRPPGGSDK_
MED1 Phosphorylation S1223 1.061 1.013 _AKS(ph)PISSGSGGSHM(ox)SGTSSSSGM(ox)K_
MED1 Phosphorylation S1433 -0.191 _NYGS(ph)PLISGSTPK_
MEN1 Ubiquitylation K8 -1.132 0.088 _AAQK(gl)TLFPLR_
MEN1 Phosphorylation S218 -0.820 _RES(ph)KPEEPPPPK_
NCOR2 Phosphorylation S939 -0.637 _LLS(ph)PRPSLLTPTGDPR_
NCOR2 Phosphorylation S943 -0.740 _LLSPRPS(ph)LLTPTGDPR_
NCOR2 Phosphorylation S956 -0.223 -0.308 _ANAS(ph)PQKPLDLK_
NCOR2 Phosphorylation S1023 -0.334 _S(ph)RSPAPPADKEAFAAEAQK_
NCOR2 Phosphorylation S1025 1.950 _SRS(ph)PAPPADKEAFAAEAQK_
NCOR2 Phosphorylation T1383 -1.746 -2.157 _EGT(ph)PPPPPPSR_
NCOR2 Phosphorylation S1479 0.325 -0.132 _SLIGS(ph)PGR_
NCOR2 Phosphorylation S1778 -0.687 _HSSSPLS(ph)PGGPTHLTKPTTTSSSER_
NCOR2 Phosphorylation S1970 -0.321 _SGLEPAS(ph)SPSK_
NCOR2 Phosphorylation S1971 -0.480 _SGLEPASS(ph)PSK_
NCOR2 Phosphorylation S2223 -0.074 -1.140 _TSVLGGGEDGIEPVS(ph)PPEGMTEPGHSR_
NCOR2 Phosphorylation S2258 -0.573 -0.210 _S(ph)PGNTSQPPAFFSK_
NCOR2 Phosphorylation S2413 0.973 _AKS(ph)PAPGLASGDRPPSVSSVHSEGDCNR_
NEDD4 Phosphorylation Y751 -0.924 _RGSLQAY(ph)TFEEQPTLPVLLPTSSGLPPGWEEK_
NEDD4 Ubiquitylation K874 0.127 _LK(gl)IPAHLR_
NEDD4 Ubiquitylation K882 -0.919 0.114 _GK(gl)TSLDTSNDLGPLPPGWEER_
NFE2L2 Ubiquitylation K65 -0.831 _QEQLQK(gl)EQEK_
OIP5 Phosphorylation S47 -1.172 _GS(ph)SPLGPAGLGAEEPAAGPQLPSWLQPER_
OIP5 Phosphorylation S48 -1.172 _GS(ph)SPLGPAGLGAEEPAAGPQLPSWLQPER_
ORC2 Phosphorylation T116 -0.144 -1.304 _LASELAKT(ph)PQK_
ORC2 Phosphorylation T226 -0.976 -1.179 _VVSAPVGKET(ph)PSK_
ORC2 Phosphorylation S228 -0.380 -0.851 _VVSAPVGKETPS(ph)KR_
PARPBP Ubiquitylation K287 -0.958 _EAFTDLK(gl)HAAR_
PARPBP Ubiquitylation K313 -2.863 _TIELGGK(gl)GYAPPPSDPLR_
PARPBP Ubiquitylation K482 -1.271 _SPTQVNNSIK(gl)PLR_
PDS5A Ubiquitylation K366 5.856 _DLTEYLK(gl)VR_
PDS5A Ubiquitylation K558 1.282 0.231 _AQDFVKK(gl)_
PDS5A Ubiquitylation K974 0.230 0.773 _QCLLK(gl)NISIR_
PDS5A Phosphorylation S1305 0.624 0.507 _RAAVGQES(ph)PGGLEAGNAK_
PDS5B Ubiquitylation K212 -0.709 _NLNK(gl)QAYDLAK_
PDS5B Phosphorylation S1160 -0.554 _M(ox)ETVSNASS(ph)SSNPSS(ph)PGR_
PDS5B Phosphorylation S1166 0.251 -0.039 _METVSNASSSSNPSS(ph)PGR_
PDS5B Phosphorylation S1257 0.679 0.856 _GHTAS(ph)ESDEQQWPEEK_
PDS5B Phosphorylation S1283 -0.320 -0.086 _RLKEDILENEDEQNS(ph)PPK_
PDS5B Phosphorylation S1358 0.352 0.386 _AES(ph)PESSAIESTQST(ph)PQK_
PDS5B Phosphorylation S1369 -0.338 _AES(ph)PESSAIESTQS(ph)TPQK_
PDS5B Phosphorylation T1370 -0.515 -0.777 _AES(ph)PESSAIESTQST(ph)PQK_
PDS5B Phosphorylation S1383 0.499 0.305 _TPS(ph)PSQPK_
POLA1 Phosphorylation S192 -0.049 -0.187 _S(ph)IGASPNPFSVHTATAVPSGK_
POLA1 Phosphorylation S196 -0.374 _RSIGAS(ph)PNPFSVHTATAVPSGK_
POLA1 Ubiquitylation K1120 -0.317 _DTIVENIQK(gl)R_
RAD18 Ubiquitylation K13 0.971 -0.795 _TVTITK(gl)EDESTEK_
RAD18 Ubiquitylation K73 -1.744 _TQCPTCCVTVTEPDLK(gl)NNR_
RAD18 Phosphorylation S99 -0.633 0.106 _NHLLQFALES(ph)PAK_
RAD18 Phosphorylation S103 1.453 1.119 _NHLLQFALESPAKS(ph)PASSSSK_
RAD18 Ubiquitylation K110 -0.405 -0.669 _SPASSSSK(gl)NLAVK_
RAD18 Ubiquitylation K110 -0.405 -0.669 _SPASSSSK(gl)NLAVK_
RAD18 Ubiquitylation K115 -0.231 -0.368 _NLAVK(gl)VYTPVASR_
RAD18 Ubiquitylation K151 0.809 0.351 _EMSGSTSELLIK(gl)ENK_
RAD18 Ubiquitylation K154 0.097 0.713 _EMSGSTSELLIKENK(gl)SK_
RAD18 Ubiquitylation K156 0.757 0.161 _SK(gl)FSPQK_
RAD18 Ubiquitylation K161 -0.335 -0.403 _FSPQK(gl)EASPAAK_
RAD18 Ubiquitylation K186 -1.903 -2.009 _SVEEIAPDPSEAK(gl)RPEPPSTSTLK_
RAD18 Ubiquitylation K197 -1.182 _RPEPPSTSTLK(gl)QVTK_
RAD18 Ubiquitylation K258 -0.742 _TVYNLLSDRDLKK(gl)_
RAD18 Ubiquitylation K261 0.601 0.053 _LK(gl)EHGLSIQGNK_
RAD18 Ubiquitylation K309 0.251 _SAAEIVQEIENIEK(gl)TR_
RAD18 Ubiquitylation K318 1.786 _LEASK(gl)LNESVMVFTK_
RAD18 Ubiquitylation K333 0.989 1.516 _DQTEK(gl)EIDEIHSK_
RAD18 Ubiquitylation K370 -0.695 _IAGMSQK(gl)TVTITK_
RAD18 Ubiquitylation K376 0.971 -0.795 _TVTITK(gl)EDESTEK_
RAD18 Phosphorylation S471 0.270 0.272 _NDLQDTEIS(ph)PR_
RAN Ubiquitylation K23 0.056 _LVLVGDGGTGK(gl)TTFVK_
RAN Ubiquitylation K37 0.841 _HLTGEFEK(gl)K_
RAN Ubiquitylation K60 -0.488 0.477 _GPIK(gl)FNVWDTAGQEK_
RAN Ubiquitylation K71 1.279 _FNVWDTAGQEK(gl)FGGLR_
RAN Ubiquitylation K116 -0.044 1.823 _VTYK(gl)NVPNWHR_
RAN Ubiquitylation K140 -0.020 0.586 _VCENIPIVLCGNK(gl)VDIK_
RAN Ubiquitylation K144 0.131 0.529 _VCENIPIVLCGNKVDIK(gl)DR_
RAN Ubiquitylation K147 0.000 _VCENIPIVLCGNKVDIKDRK(gl)_
RAN Ubiquitylation K151 1.342 0.712 _AK(gl)SIVFHR_
RAN Ubiquitylation K158 0.185 0.370 _K(gl)KNLQYYDISAK_
RAN Ubiquitylation K159 0.246 0.274 _K(gl)NLQYYDISAK_
RAN Ubiquitylation K176 1.593 _SNYNFEK(gl)PFLWLAR_
RB1 Phosphorylation S69 -3.602 -3.397 _TAATAAAAAAEPPAPPPPPPPEEDPEQDS(ph)GPEDLPLVR_
RB1 Ubiquitylation K97 -0.546 _LK(gl)IPDHVR_
RB1 Phosphorylation T388 0.005 0.116 _TLQTDSIDSFETQRT(ph)PR_
RB1 Phosphorylation T405 -0.851 -0.901 _KSNLDEEVNVIPPHT(ph)PVR_
RB1 Phosphorylation S820 -0.019 _S(ph)PYKFPSSPLR_
RB1 Ubiquitylation K823 -2.214 _SPYK(gl)FPSSPLR_
RB1 Phosphorylation S827 0.824 0.111 _FPSS(ph)PLR_
RB1 Phosphorylation S839 -0.701 -1.045 _IPGGNIYIS(ph)PLKS(ph)PYK_
RB1 Ubiquitylation K842 -0.751 _IPGGNIYISPLK(gl)SPYK_
RB1 Phosphorylation S843 -0.701 -0.022 _IPGGNIYIS(ph)PLKS(ph)PYK_
RB1 Ubiquitylation K846 -2.084 _SPYK(gl)ISEGLPTPTK_
RB1 Phosphorylation T853 0.039 -0.555 _ISEGLPT(ph)PTKM(ox)T(ph)PR_
RB1 Ubiquitylation K856 -1.350 _ISEGLPTPTK(gl)MTPR_
RB1 Phosphorylation T858 -0.782 0.564 _ISEGLPT(ph)PTKMT(ph)PR_
RB1 Ubiquitylation K879 -0.187 _FQK(gl)INQMVCNSDR_
RCOR2 Phosphorylation S63 0.022 -0.266 _VGTNYQAVIPECKPES(ph)PAR_
RCOR2 Phosphorylation S124 0.641 _S(ph)QERDNLGMLVWSPNQNLSEAK_
RCOR2 Ubiquitylation K156 1.766 _LDEYIAIAKEK(gl)_
RCOR2 Phosphorylation S213 -0.586 -0.539 _GGVS(ph)EGEPDPADPK_
RCOR2 Phosphorylation S257 -0.356 _REREES(ph)EDELEEANGNNPIDIEVDQNK_
SIN3A Ubiquitylation K155 0.182 _EFK(gl)SQSIDTPGVISR_
SIN3A Phosphorylation T266 -0.572 _VSKPSQLQAHTPASQQT(ph)PPLPPYASPR_
SIN3A Phosphorylation S277 -1.598 _S(ph)PPVQPHTPVTISLGTAPSLQNNQPVEFNHAINYVNK_
SIN3A Phosphorylation S295 -1.959 _SPPVQPHTPVTISLGTAPS(ph)LQNNQPVEFNHAINYVNK_
SIN3A Ubiquitylation K638 -0.223 _VLEAIQK(gl)K_
SIN3A Ubiquitylation K639 -0.223 _VLEAIQK(gl)K_
SIN3A Ubiquitylation K715 1.012 _GFNK(gl)VWR_
SIN3A Phosphorylation S832 0.764 0.363 _GDLS(ph)DVEEEEEEEM(ox)DVDEATGAVKK_
SIN3A Ubiquitylation K875 0.131 0.003 _LLFSNTAAQK(gl)LR_
SIN3A Ubiquitylation K937 -0.224 -0.025 _DK(gl)SDSPAIQLR_
SIN3A Phosphorylation S940 -0.107 _DKSDS(ph)PAIQLR_
SIN3A Phosphorylation T1111 0.691 0.517 _YM(ox)NSDTT(ph)SPELR_
SIN3A Phosphorylation S1112 0.623 0.725 _YM(ox)NSDTTS(ph)PELR_
SIRT1 Phosphorylation S14 -0.369 -0.246 _(ac)ADEAALALQPGGS(ph)PSAAGADR_
SIRT1 Phosphorylation S16 -0.306 -1.665 _(ac)ADEAALALQPGGS(ph)PS(ph)AAGADREAASSPAGEPLR_
SIRT1 Phosphorylation S26 -1.047 -0.245 _EAAS(ph)SPAGEPLR_
SIRT1 Phosphorylation S27 0.351 -0.363 _EAASS(ph)PAGEPLR_
SIRT1 Phosphorylation S47 -0.574 -0.607 _S(ph)PGEPGGAAPER_
SIRT1 Ubiquitylation K238 -1.641 _RK(gl)DINTIEDAVK_
SIRT1 Ubiquitylation K499 -2.138 -0.204 _LGGEYAK(gl)LCCNPVK_
SIRT1 Ubiquitylation K578 -2.782 _GCMEEK(gl)PQEVQTSR_
SIRT1 Ubiquitylation K601 -3.051 _NVESIAEQMENPDLK(gl)NVGSSTGEK_
SMC3 Ubiquitylation K106 0.087 _K(gl)DQYFLDKK_
SMC3 Ubiquitylation K140 -0.351 0.443 _SNPYYIVK(gl)QGK_
SMC3 Ubiquitylation K143 -1.015 0.329 _QGK(gl)INQMATAPDSQR_
SMC3 Ubiquitylation K172 0.044 0.537 _VYDERK(gl)EESISLMK_
SMC3 Ubiquitylation K180 0.000 _KEESISLM(ox)K(gl)ETEGKR_
SMC3 Ubiquitylation K188 0.711 _EK(gl)INELLK_
SMC3 Ubiquitylation K194 0.447 0.876 _INELLK(gl)YIEER_
SMC3 Ubiquitylation K459 0.122 _YYEVK(gl)NK_
SMC3 Ubiquitylation K461 0.122 _YYEVK(gl)NK_
SMC3 Ubiquitylation K968 1.085 _K(gl)LEQCNTELKK_
SMC3 Ubiquitylation K977 0.607 _KLEQCNTELK(gl)K_
SMC3 Ubiquitylation K1025 0.441 _K(gl)YEAIQLTFK_
SMC3 Ubiquitylation K1034 0.865 _KYEAIQLTFK(gl)QVSK_
SMC3 Ubiquitylation K1038 0.959 _QVSK(gl)NFSEVFQK_
SMC3 Phosphorylation S1065 1.113 _GDVEGS(ph)QSQDEGEGSGESER_
SMC3 Phosphorylation S1067 1.197 1.207 _KGDVEGSQS(ph)QDEGEGSGESER_
SMC3 Phosphorylation S1081 3.980 3.931 _GS(ph)GSQSSVPSVDQFTGVGIR_
SMC3 Phosphorylation S1083 4.043 3.766 _GSGS(ph)QSSVPSVDQFTGVGIR_
SMC3 Phosphorylation S1085 3.316 _GSGSQS(ph)SVPSVDQFTGVGIR_
SMC3 Phosphorylation S1086 3.710 _GSGSQSS(ph)VPSVDQFTGVGIR_
SMC3 Ubiquitylation K1105 0.634 1.207 _VSFTGK(gl)QGEMR_
SMC3 Ubiquitylation K1194 0.816 _NK(gl)VSHIDVITAEMAK_
SNW1 Ubiquitylation K193 1.500 _YTPSQQGVAFNSGAK(gl)QR_
SNW1 Phosphorylation S224 -0.528 0.034 _GPPS(ph)PPAPVMHSPS(ph)RK_
SNW1 Phosphorylation S232 -1.645 -1.722 _GPPS(ph)PPAPVMHS(ph)PSR_
SNW1 Phosphorylation S234 -1.881 _GPPS(ph)PPAPVMHSPS(ph)RK_
STAG1 Ubiquitylation K270 -0.214 0.529 _LELLLQK(gl)R_
STAG2 Ubiquitylation K270 -0.214 0.529 _LELLLQK(gl)R_
STAG2 Ubiquitylation K449 -0.454 _RDPEEDGMMK(gl)R_
STAG2 Ubiquitylation K755 0.039 _ITESSSTK(gl)EDLLR_
STAG2 Phosphorylation S1061 0.668 0.663 _NSLLAGGDDDTMSVIS(ph)GISSR_
STAG2 Phosphorylation S1064 0.577 0.254 _NSLLAGGDDDTMSVISGIS(ph)SR_
STAG2 Phosphorylation S1065 0.596 _NSLLAGGDDDTM(ox)SVISGISS(ph)R_
STAG2 Phosphorylation T1112 0.806 _EQTLHT(ph)PVMMQTPQLTSTIMR_
STAG2 Phosphorylation T1197 0.563 0.120 _GT(ph)SLMEDDEEPIVEDVMMSSEGR_
STAG2 Phosphorylation S1198 0.563 0.016 _GTS(ph)LM(ox)EDDEEPIVEDVMMSSEGR_
SUV39H2 Ubiquitylation K129 0.974 _TLKPAIAEYIVK(gl)K_
SUV39H2 Ubiquitylation K130 0.678 0.667 _TLKPAIAEYIVKK(gl)_
SUV39H2 Phosphorylation S388 -0.691 -0.068 _GSGDISSDSIDHS(ph)PAKK_
TMPO Phosphorylation S66 -0.409 -0.162 _GPPDFS(ph)SDEEREPTPVLGSGAAAAGR_
TMPO Phosphorylation S67 -0.758 -0.434 _GPPDFSS(ph)DEEREPTPVLGSGAAAAGR_
TMPO Phosphorylation T74 -0.746 -1.414 _GPPDFSSDEEREPT(ph)PVLGSGAAAAGR_
TMPO Phosphorylation S158 0.035 -0.983 _S(ph)STPLPTISSSAENTR_
TMPO Phosphorylation T160 0.243 -0.889 _SST(ph)PLPTISSSAENTR_
TMPO Phosphorylation T164 -1.020 _S(ph)STPLPT(ph)ISSSAENTR_
TMPO Phosphorylation S166 -0.979 _SST(ph)PLPTIS(ph)SSAENTR_
TMPO Phosphorylation S167 0.070 -1.235 _S(ph)STPLPTISS(ph)SAENTR_
TMPO Phosphorylation S184 0.671 _QNGSNDSDRYS(ph)DNEEDSKIELK_
TMPO Phosphorylation T208 0.142 -0.074 _AKT(ph)PVTLK_
TMPO Ubiquitylation K213 -0.188 0.196 _TPVTLK(gl)QR_
TMPO Phosphorylation S224 1.514 _RVEHNQSYS(ph)QAGITETEWTSGSSK_
TMPO Phosphorylation T247 1.340 _GGPLQALT(ph)RESTR_
TMPO Phosphorylation S250 -0.342 -0.058 _GGPLQALTRES(ph)TR_
TMPO Phosphorylation S276 -0.938 _IDGPVIS(ph)ESTPIAETIMASSNESLVVNR_
TMPO Phosphorylation S291 1.067 _S(ph)SSSSSQPEHSAMLVSTAASPSLIK_
TMPO Phosphorylation S293 0.066 1.213 _SSS(ph)SSSQPEHSAMLVSTAASPSLIK_
TMPO Phosphorylation S296 0.295 _SSSSSS(ph)QPEHSAMLVSTAASPSLIK_
TMPO Phosphorylation S301 0.735 1.087 _SSSSSSQPEHS(ph)AM(ox)LVSTAASPSLIK_
TMPO Phosphorylation S306 -1.540 -0.863 _HAS(ph)PILPITEFSDIPR_
TMPO Phosphorylation S310 1.456 -0.147 _SSSSSSQPEHSAMLVSTAAS(ph)PSLIK_
TMPO Ubiquitylation K323 0.295 _ETTTGYYK(gl)DIVENICGR_
TMPO Ubiquitylation K334 -1.660 _EK(gl)SGIQPLCPER_
TMPO Ubiquitylation K334 0.248 _AEVGEK(gl)TEER_
TMPO Phosphorylation S351 0.260 -0.013 _SHISDQS(ph)PLSSK_
TMPO Phosphorylation S354 -0.183 0.458 _SHISDQSPLS(ph)SK_
TMPO Phosphorylation S355 -0.223 0.440 _SHISDQSPLSS(ph)K_
TMPO Phosphorylation T355 -0.542 -1.007 _EMFPYEAST(ph)PTGISASCR_
TMPO Ubiquitylation K356 -0.010 -1.409 _SHISDQSPLSSK(gl)R_
TMPO Ubiquitylation K389 -0.432 0.012 _MEESFSSK(gl)YVPK_
TMPO Ubiquitylation K393 -1.116 -0.783 _YVPK(gl)YVPLADVK_
TMPO Ubiquitylation K401 -0.880 -0.191 _YVPLADVK(gl)SEK_
TMPO Ubiquitylation K404 -0.454 _YVPLADVKSEK(gl)_
TMPO Phosphorylation S424 -0.254 -0.005 _FQETEFLS(ph)PPR_
TMPO Ubiquitylation K435 4.273 10.564 _LSEK(gl)SVEER_
TMPO Phosphorylation S436 0.403 _LSEKS(ph)VEER_
TMPO Phosphorylation S442 1.247 _DS(ph)GSFVAFQNIPGSELMSSFAK_
TMPO Phosphorylation S444 1.247 _DS(ph)GSFVAFQNIPGSELMSSFAK_
TMPO Ubiquitylation K667 -1.096 _NK(gl)LASTPFK_
TOX4 Phosphorylation T175 0.465 _LST(ph)TPSPTSSLHEDGVEDFRR_
TOX4 Phosphorylation S178 0.750 0.447 _LSTTPS(ph)PTSSLHEDGVEDFRR_
TOX4 Ubiquitylation K494 -3.056 _INLQQQPPPLQIK(gl)SVPLPTLK_
TP53 Ubiquitylation K120 -0.188 _LGFLHSGTAK(gl)SVTCTYSPALNK_
TP53 Ubiquitylation K164 0.157 -1.260 _AMAIYK(gl)QSQHMTEVVR_
TP53 Phosphorylation S314 -0.695 -1.000 _ALPNNTSS(ph)SPQPK_
TP53 Phosphorylation S315 -0.762 -0.959 _RALPNNTSSS(ph)PQPK_
TP53 Ubiquitylation K320 -0.978 _ALPNNTSSSPQPKK(gl)_
TP53 Ubiquitylation K357 -0.231 -0.823 _ELNEALELKDAQAGK(gl)EPGGSR_
TRIM28 Phosphorylation S4 -0.337 _(ac)AAS(ph)AAAASAAAASAASGSPGPGEGSAGGEK_
TRIM28 Phosphorylation S14 -0.154 _(ac)AASAAAASAAAAS(ph)AASGSPGPGEGSAGGEK_
TRIM28 Phosphorylation S17 -0.227 -0.026 _(ac)AASAAAASAAAASAAS(ph)GSPGPGEGSAGGEK_
TRIM28 Phosphorylation S19 -0.068 -0.189 _(ac)AASAAAASAAAASAASGS(ph)PGPGEGSAGGEK_
TRIM28 Phosphorylation S26 0.197 _(ac)AASAAAASAAAASAASGSPGPGEGS(ph)AGGEK_
TRIM28 Phosphorylation S41 0.373 _RSTAPSAAAS(ph)ASASAAASSPAGGGAEALELLEHCGVCR_
TRIM28 Phosphorylation S43 0.010 _RSTAPSAAASAS(ph)ASAAASSPAGGGAEALELLEHCGVCR_
TRIM28 Phosphorylation S49 -0.388 -0.110 _STAPSAAASASASAAAS(ph)SPAGGGAEALELLEHCGVCR_
TRIM28 Phosphorylation S50 -0.113 0.075 _RSTAPSAAASASASAAASS(ph)PAGGGAEALELLEHCGVCR_
TRIM28 Ubiquitylation K254 0.323 0.381 _K(gl)LLASLVK_
TRIM28 Ubiquitylation K261 1.520 0.923 _LLASLVK(gl)R_
TRIM28 Ubiquitylation K266 0.465 -0.005 _LGDK(gl)HATLQK_
TRIM28 Ubiquitylation K272 1.576 -0.085 _LGDKHATLQK(gl)STK_
TRIM28 Ubiquitylation K319 0.332 0.451 _VLVNDAQK(gl)VTEGQQER_
TRIM28 Ubiquitylation K337 0.976 _QHWTM(ox)TK(gl)IQK_
TRIM28 Ubiquitylation K340 0.112 -0.105 _IQK(gl)HQEHILR_
TRIM28 Ubiquitylation K407 -2.105 _SAEAFGK(gl)IVAERPGTNSTGPAPMAPPR_
TRIM28 Phosphorylation S471 3.215 2.215 _S(ph)RSGEGEVSGLM(ox)R_
TRIM28 Phosphorylation S473 3.049 2.476 _S(ph)GEGEVSGLMR_
TRIM28 Phosphorylation S489 0.264 0.043 _VS(ph)LERLDLDLTADSQPPVFK_
TRIM28 Phosphorylation T498 0.265 _VSLERLDLDLT(ph)ADSQPPVFK_
TRIM28 Phosphorylation T541 3.001 1.292 _GAAAAATGQPGTAPAGT(ph)PGAPPLAGMAIVK_
TRIM28 Phosphorylation S594 1.033 _LAS(ph)PSGSTSSGLEVVAPEGTSAPGGGPGTLDDSATICR_
TRIM28 Phosphorylation S624 -1.117 _LASPSGSTSSGLEVVAPEGTSAPGGGPGTLDDS(ph)ATICR_
TRIM28 Phosphorylation S681 1.735 _EEDGS(ph)LSLDGADSTGVVAK_
TRIM28 Phosphorylation S752 0.314 0.567 _LQEKLS(ph)PPYSSPQEFAQDVGR_
TRIM28 Phosphorylation S756 -0.408 _LSPPYS(ph)SPQEFAQDVGR_
TRIM28 Ubiquitylation K770 0.289 _MFK(gl)QFNK_
TRIM28 Ubiquitylation K779 0.334 2.706 _LTEDK(gl)ADVQSIIGLQR_
UBR2 Ubiquitylation K779 -0.314 -0.531 _FSPGVGQVNATDEIK(gl)R_
UBR2 Phosphorylation S1006 0.165 0.550 _ESS(ph)PTSPVAETEGTIMEESSR_
UBR2 Phosphorylation S1009 0.446 _ESSPTS(ph)PVAETEGTIMEESSR_
UBR2 Ubiquitylation K1138 -1.146 _STVLSK(gl)NR_
UBR2 Ubiquitylation K1187 0.360 0.824 _YFDSVQAK(gl)EQRR_
UPF1 Ubiquitylation K321 0.611 _LK(gl)ESQTQDNITVR_
UPF1 Ubiquitylation K340 -1.693 _WDLGLNKK(gl)_
UPF1 Ubiquitylation K378 -1.658 _YK(gl)GDLAPLWK_
UPF1 Ubiquitylation K638 -2.024 -0.456 _LAK(gl)MQFR_
UPF1 Ubiquitylation K790 0.647 0.880 _ITTK(gl)LLK_
UPF1 Ubiquitylation K793 -2.075 _LLK(gl)AGAKPDQIGIITPYEGQR_
UPF1 Phosphorylation S1107 0.100 0.763 _SQIDVALS(ph)QDSTYQGER_
WAPAL Phosphorylation S77 0.020 _VEEESTGDPFGFDS(ph)DDESLPVSSK_
WAPAL Phosphorylation S221 -0.285 -0.043 _RPES(ph)PSEISPIK_
WAPAL Phosphorylation S223 -0.180 0.118 _RPESPS(ph)EISPIK_
WAPAL Phosphorylation S226 -0.473 -0.494 _RPES(ph)PSEIS(ph)PIKGSVR_
WAPAL Phosphorylation S380 -0.868 _S(ph)MDEFTASTPADLGEAGR_
WDR82 Ubiquitylation K2 0.623 _MK(gl)LTDSVLR_
WDR82 Ubiquitylation K63 -0.009 _K(gl)YGVDLIR_


.

© Copyright Svejstrup Laboratory 2015