bioLOGIC Data » bioLOGIC CategoryView » bioLOGIC VennView » Experimental Details »

bioLOGIC Category

Results for the Category
insulin receptor signaling pathway
(GO:0008286)

RNAi screen result RNAPII IP (MG132) CSB IP CSB IP (MG132) Chrom. Chrom. (MG132) Ubi /Phospo Ubi /Phospho (MG132)
W

Protein Results:

 Results for post-translational modifications (below)
Gene name MGoogle Score RNAi high RNAi low RNAPII-IP (MG132) CSB-IP CSB-IP (MG132) Chrom. Chrom. (MG132)
RPS6 5 -1.590 2.890 0.202 -0.347 -0.009 -0.153 0.152
ATP6V1H 2 -1.810 2.860 0.325
ATP6V1H 2 -1.810 2.860 -0.409
EEF2K 2 -1.120 2.610
GSK3A 2 -1.420 1.510 -1.128 1.091
GSK3A 2 -1.420 1.510
FOXO3 2 -0.410 -0.120
PHIP 2 0.650 -0.230 0.434 0.305
INSR 2 -0.850 0.830 1.143 0.785
TSC2 1 0.810 -0.710
TSC2 1 0.810 -0.710 -0.715
PIK3R2 1 2.740 -1.180 0.269 0.348
RHEB 1 2.630 -1.320 0.991 -0.417
EIF4G1 1 -1.660 2.810 0.765
EIF4G1 1 -1.660 2.810 -0.451 -0.932 -0.258 -0.331
RAF1 1 2.020 -1.230
KRAS 1 -0.510 0.620 1.031 0.887
KRAS 1 -0.510 0.620 0.246 -0.346
IGF1R 1 -0.490 0.750 1.476 0.714
ATP6V1B2 1 -1.700 3.610 -0.526 0.143
EIF4E 1 -2.250 4.200 0.590 0.156
EIF4E 1 -2.250 4.200 0.369
ATP6V0D1 1 -0.960 0.640
ATP6V0D1 1 -0.960 0.640 -0.252 -0.493 2.836
MAP2K1 1 -1.590 2.780
EIF4EBP1 1 2.050 -1.320
PIK3R4 1 1.400 -0.950 1.537 -1.555 0.077
NRAS 1 1.810 -0.720 0.246 -0.346
PDK2 0 0.920 -0.730
PIK3C2A 0 0.620 -0.690 -0.145 0.459
ATP6V0A1 0 -0.580 0.460 -0.439 0.009
PIK3CB 0 -1.390 2.350
PIK3CB 0 -0.710 1.450
EIF4B 0 -0.020 0.470 -0.169 -0.233 -0.211 -0.927 -0.212
PRKCZ 0 -0.290 0.310
FGFR3 0 -1.120 1.390
SREBF1 0 0.540 -0.490
SREBF1 0 0.540 -0.490
FGFR1 0 0.210 0.150
PIK3C3 0 -0.260 0.520
SORBS1 0 0.660 -0.330
ATP6V1D 0 1.770 -0.910 0.833 0.523
PPM1A 0 -0.680 1.340 0.402
PPM1A 0 -0.680 1.340 -1.556 -0.874
MAPK3 0
ZNF106 0 1.230 -1.240 -0.040 -0.199
AKT2 0 -1.420 2.210 -0.194
GRB10 0 0.900 -0.860
PRKAG2 0 1.300 -0.990 0.278 -0.667
RPS6KB1 0 0.850 -0.600
GAB1 0 1.950 -1.110
PRKAB1 0 0.640 -1.180
ATP6V1A 0 -0.790 0.280 0.981 0.151 0.014
SOS1 0 0.500 -0.620 -0.570
ATP6V1B1 0 1.440 -1.080 -0.526 0.143
PIK3R3 0 -0.140 -0.480
PIK3R3 0 -0.140 -0.480 -0.441 0.147
STK11 0
RHOQ 0 0.310 -0.560 0.486 -0.364 -0.568
RHOQ 0 1.120 -0.210 0.486 -0.364 -0.568
RHOQ 0 0.310 -0.560
RHOQ 0 1.120 -0.210
IDE 0 -0.890 1.510 -1.202
PIK3CA 0
MAP2K2 0 -0.610 0.080
MAP2K2 0 -0.610 0.080
ATP6V1E1 0 -0.180 0.310 -0.346 -2.246
PRKAA1 0 0.910 0.060
PTPRA 0 0.890 -0.870 0.212 1.021
CAB39 0 -0.920 0.670
ATP6V1G1 0 0.090 -0.400
ATP6V1G1 0 0.090 -0.400
ATP6V1G2 0 -0.040 0.160
ATP6V1G2 0 -0.040 0.160
ATP6V1G2-D 0
ATP6V1G2-D 0
PDPK1 0 0.050 -0.440
RPTOR 0 0.520 -1.030 0.623 0.466
AKT1 0 -0.050 0.700
AKT1 0 0.860 -0.040
PIK3R1 0 1.910 -1.220 -0.441 0.147
EIF4EBP2 0 1.140 -0.720
ATP6V1C1 0
APPL1 0 1.130 -0.340
PRKAA2 0 -0.030 -0.350
PRKAA2 0 -0.030 -0.350
TSC1 0 1.100 -0.150
STXBP4 0 0.810 0.110
YWHAB 0 0.628 -0.543
YWHAB 0 0.507 0.271 0.503
CRK 0 -0.790 0.230
MLST8 0 -0.170 0.220
IRS1 0
CDK1 0 -0.370 0.080 -0.202 -0.884 -0.107 -0.097 -0.501
SMARCC1 0 0.140 0.090 0.553 0.112 0.584 0.137 0.136
HRAS 0 1.470 -0.520
PTPN2 0 1.210 -0.730
FOXG1 0 -0.510 1.000 -1.217 -0.424 0.659
FOXG1 0 0.550 -0.250 -1.217 -0.424 0.659
AP3S1 0 1.210 -1.210 -1.064 -0.141
GRB2 0 -0.240 0.300 -1.021 0.057 0.906
PTPN11 0 -0.210 -0.400 0.644 1.053 0.451
PRKAG1 0 0.400 -0.420 0.278 -0.667
ATP6V0A2 0 1.190 -0.740 0.137 -0.457
IRS2 0 -0.190 -0.130
PTPN1 0 -0.150 0.310 1.066 0.459 0.251 0.322 0.379
MTOR 0 -0.680 0.150 0.757 0.074 0.101
ATP6V1E2 0 -0.020 -0.010
STRADA 0

PTM Sites:

 Back to Protein Results
Gene name PTM type PTM site UV UV (MG132) Sequence
AKT1 Phosphorylation S124 0.252 0.311 _SGS(ph)PSDNSGAEEMEVSLAKPK_
AKT1 Phosphorylation S126 -0.241 _SGSPS(ph)DNSGAEEM(ox)EVSLAK_
AKT1 Ubiquitylation K301 0.988 _EGIK(gl)DGATMK_
AKT2 Ubiquitylation K14 0.306 0.070 _EGWLHK(gl)R_
AKT2 Ubiquitylation K111 1.082 _AIQMVANSLK(gl)QR_
AKT2 Ubiquitylation K160 0.251 _LLGK(gl)GTFGK_
AKT2 Phosphorylation T451 -0.091 -0.612 _YFDDEFTAQSITIT(ph)PPDRYDSLGLLELDQR_
AKT2 Phosphorylation Y456 -0.265 _YFDDEFTAQSITITPPDRY(ph)DSLGLLELDQR_
AP3S1 Ubiquitylation K18 -0.109 0.558 _LSK(gl)FYQPYSEDTQQQIIR_
AP3S1 Ubiquitylation K166 -0.248 _AVSAVK(gl)NMNLPEIPR_
AP3S1 Ubiquitylation K193 -0.977 _VPNLPSFK(gl)_
APPL1 Ubiquitylation K66 -1.174 0.359 _LLK(gl)EYEK_
APPL1 Ubiquitylation K124 -0.697 _DLK(gl)EILTLK_
APPL1 Ubiquitylation K289 0.154 _NK(gl)TGLVSSTWDR_
APPL1 Ubiquitylation K351 -0.236 0.892 _YCFQITSFDGKK(gl)_
APPL1 Phosphorylation T399 -0.185 _VNQSALEAVT(ph)PSPSFQQR_
APPL1 Phosphorylation S401 -0.233 -0.423 _VNQSALEAVTPS(ph)PSFQQR_
APPL1 Ubiquitylation K638 -0.311 0.401 _ASEK(gl)QKEIER_
ATP6V0A1 Ubiquitylation K119 0.578 _EINTNQEALK(gl)R_
ATP6V0A1 Ubiquitylation K235 0.326 _K(gl)ICEGFR_
ATP6V0A1 Ubiquitylation K255 0.143 _K(gl)EMASGVNTR_
ATP6V0A1 Ubiquitylation K366 -0.441 _MQTNQTPPTYNK(gl)TNK_
ATP6V0A1 Ubiquitylation K369 -1.113 -0.322 _MQTNQTPPTYNKTNK(gl)_
ATP6V0A2 Ubiquitylation K136 0.287 _VTK(gl)TFVKR_
ATP6V0A2 Ubiquitylation K290 0.039 -0.079 _QVLCK(gl)AAESVYSR_
ATP6V0A2 Phosphorylation S695 0.705 0.859 _KDS(ph)EEEVSLLGSQDIEEGNHQVEDGCR_
ATP6V0D1 Ubiquitylation K384 0.065 -0.172 _AK(gl)IDNYIPIF_
ATP6V1A Ubiquitylation K5 -0.075 -0.921 _(ac)MDFSK(gl)LPK_
ATP6V1A Ubiquitylation K132 0.567 _DIK(gl)WDFTPCK_
ATP6V1A Ubiquitylation K139 -1.426 -0.412 _WDFTPCK(gl)NLR_
ATP6V1A Ubiquitylation K393 -0.894 _VK(gl)CLGNPER_
ATP6V1A Ubiquitylation K516 -0.571 _LIK(gl)DDFLQQNGYTPYDR_
ATP6V1C1 Ubiquitylation K28 -0.393 _LHAATSK(gl)NNNLAVTSK_
ATP6V1E1 Ubiquitylation K10 0.069 -0.101 _(ac)ALSDADVQK(gl)QIK_
ATP6V1E1 Ubiquitylation K145 -2.187 -0.725 _KQDFPLVK(gl)AAVQK_
ATP6V1E1 Ubiquitylation K150 -0.749 _AAVQK(gl)AIPMYK_
ATP6V1E1 Ubiquitylation K156 -1.382 _AIPMYK(gl)IATK_
ATP6V1E2 Ubiquitylation K10 0.468 _ALSDVDVKK(gl)_
ATP6V1G1 Phosphorylation S3 1.440 _(ac)AS(ph)QSQGIQQLLQAEK_
ATP6V1G1 Ubiquitylation K16 0.071 _(ac)ASQSQGIQQLLQAEK(gl)R_
ATP6V1G2 Phosphorylation S3 1.440 _(ac)AS(ph)QSQGIQQLLQAEK_
ATP6V1G2 Ubiquitylation K16 0.071 _(ac)ASQSQGIQQLLQAEK(gl)R_
ATP6V1G2-DDX39B Phosphorylation S3 1.440 _(ac)AS(ph)QSQGIQQLLQAEK_
ATP6V1G2-DDX39B Ubiquitylation K16 0.071 _(ac)ASQSQGIQQLLQAEK(gl)R_
ATP6V1H Ubiquitylation K176 1.541 0.958 _TQLSSQK(gl)LR_
CAB39 Ubiquitylation K20 0.992 _NLK(gl)ESMAVLEK_
CDK1 Ubiquitylation K6 0.011 -0.784 _(ac)M(ox)EDYTK(gl)IEK_
CDK1 Ubiquitylation K20 -0.327 -0.270 _IGEGTYGVVYK(gl)GR_
CDK1 Ubiquitylation K33 0.736 0.239 _TTGQVVAMK(gl)K_
CDK1 Ubiquitylation K34 -0.306 _TTGQVVAMKK(gl)_
CDK1 Ubiquitylation K58 0.312 -0.262 _EISLLK(gl)ELR_
CDK1 Ubiquitylation K136 -0.468 _DLK(gl)PQNLLIDDK(gl)GTIK_
CDK1 Ubiquitylation K145 0.161 -0.954 _DLKPQNLLIDDK(gl)GTIK_
CDK1 Ubiquitylation K149 -0.038 _GTIK(gl)LADFGLAR_
CDK1 Ubiquitylation K251 -0.047 -1.236 _WK(gl)PGSLASHVK_
CDK1 Ubiquitylation K280 0.179 -1.210 _MLIYDPAK(gl)R_
CRK Phosphorylation S40 0.533 0.363 _DS(ph)STSPGDYVLSVSENSR_
CRK Phosphorylation S41 1.065 0.801 _DSS(ph)TSPGDYVLSVSENSR_
EEF2K Phosphorylation S18 0.197 0.661 _LEGVDGGQS(ph)PR_
EEF2K Ubiquitylation K65 0.734 _YYSNLTK(gl)SER_
EEF2K Ubiquitylation K341 2.006 -0.155 _DAVNQNTK(gl)LLQSAK_
EEF2K Phosphorylation S445 -0.049 _ESENSGDSGYPS(ph)EKRGELDDPEPR_
EEF2K Phosphorylation S470 0.044 0.565 _KYES(ph)DEDSLGSSGR_
EEF2K Ubiquitylation K485 1.702 1.119 _VCVEK(gl)WNLLNSSR_
EIF4B Phosphorylation S93 -0.425 -0.444 _S(ph)PPYTAFLGNLPYDVTEESIKEFFR_
EIF4B Phosphorylation S207 -0.235 0.162 _ARPATDS(ph)FDDYPPR_
EIF4B Phosphorylation S283 0.453 0.543 _AFGS(ph)GYR_
EIF4B Ubiquitylation K365 0.071 _AASIFGGAK(gl)PVDTAAR_
EIF4B Phosphorylation S464 -0.446 0.097 _EEDCHS(ph)PTSKPPKPDQPLK_
EIF4E Ubiquitylation K147 -0.433 0.065 _WLITLNK(gl)QQR_
EIF4EBP1 Phosphorylation Y34 -1.060 _RVVLGDGVQLPPGDY(ph)STTPGGTLFS(ph)TTPGGTR_
EIF4EBP1 Phosphorylation S35 -0.849 _RVVLGDGVQLPPGDYS(ph)TTPGGTLFS(ph)TTPGGTR_
EIF4EBP1 Phosphorylation T37 -0.768 -0.583 _RVVLGDGVQLPPGDYSTT(ph)PGGTLFSTT(ph)PGGTR_
EIF4EBP1 Phosphorylation T41 -3.655 -0.903 _RVVLGDGVQLPPGDYST(ph)TPGGT(ph)LFSTTPGGTR_
EIF4EBP1 Phosphorylation S44 -0.796 _VVLGDGVQLPPGDYSTTPGGTLFS(ph)T(ph)TPGGTR_
EIF4EBP1 Phosphorylation T45 -0.727 _VVLGDGVQLPPGDYSTTPGGTLFS(ph)T(ph)TPGGTR_
EIF4EBP1 Phosphorylation T46 -0.890 -0.817 _RVVLGDGVQLPPGDYSTT(ph)PGGTLFSTT(ph)PGGTR_
EIF4EBP1 Phosphorylation S65 0.522 0.478 _NS(ph)PVTKT(ph)PPR_
EIF4EBP1 Phosphorylation T68 -1.621 -2.402 _NS(ph)PVT(ph)KTPPRDLPTIPGVTSPSSDEPPMEASQSHLR_
EIF4EBP1 Ubiquitylation K69 -1.171 -1.547 _NSPVTK(gl)TPPR_
EIF4EBP1 Phosphorylation T70 -0.702 -0.017 _NSPVTKT(ph)PPR_
EIF4EBP1 Phosphorylation T77 -1.921 -1.898 _TPPRDLPT(ph)IPGVTSPSSDEPPMEASQSHLR_
EIF4EBP1 Phosphorylation T82 1.253 _DLPTIPGVT(ph)SPSSDEPPMEASQSHLR_
EIF4EBP1 Phosphorylation S83 1.211 0.339 _DLPTIPGVTS(ph)PSSDEPPMEASQSHLR_
EIF4EBP1 Phosphorylation S96 -1.541 _DLPTIPGVTSPSSDEPPMEASQS(ph)HLRNSPEDK_
EIF4EBP1 Phosphorylation S101 -1.900 -1.976 _DLPTIPGVTSPSSDEPPMEASQSHLRNS(ph)PEDK_
EIF4EBP2 Phosphorylation Y34 -0.496 -0.320 _TVAISDAAQLPHDY(ph)CTTPGGTLFSTT(ph)PGGTR_
EIF4EBP2 Phosphorylation T37 -0.389 -0.339 _TVAISDAAQLPHDYCTT(ph)PGGTLFST(ph)TPGGTR_
EIF4EBP2 Phosphorylation T41 -0.111 _TVAISDAAQLPHDYCTTPGGT(ph)LFST(ph)TPGGTR_
EIF4EBP2 Phosphorylation T45 -0.113 _TVAISDAAQLPHDYCTTPGGT(ph)LFST(ph)TPGGTR_
EIF4EBP2 Phosphorylation T46 -0.240 -0.084 _TVAISDAAQLPHDYCTTPGGTLFSTT(ph)PGGTR_
EIF4G1 Ubiquitylation K627 -0.658 _SDQWK(gl)PLNLEEK_
EIF4G1 Ubiquitylation K635 -1.721 -1.834 _SDQWKPLNLEEKK(gl)_
EIF4G1 Phosphorylation T672 -1.605 _ANKT(ph)PLRPLDPTR_
EIF4G1 Ubiquitylation K925 0.326 _SLGNIK(gl)FIGELFK_
EIF4G1 Ubiquitylation K975 -0.759 _DLDFEK(gl)AKPR_
EIF4G1 Phosphorylation T1098 -0.123 _IT(ph)KPGSIDSNNQLFAPGGR_
EIF4G1 Phosphorylation S1102 0.238 -0.562 _ITKPGS(ph)IDSNNQLFAPGGR_
EIF4G1 Phosphorylation S1117 -0.554 _ITKPGSIDSNNQLFAPGGRLS(ph)WGK_
EIF4G1 Phosphorylation S1210 0.417 1.061 _S(ph)FSKEVEER_
EIF4G1 Phosphorylation S1212 1.007 0.725 _RSFS(ph)KEVEER_
EIF4G1 Phosphorylation S1234 0.676 1.054 _AAS(ph)LTEDRDR_
EIF4G1 Phosphorylation T1236 1.002 _KAAS(ph)LTEDRDR_
EIF4G1 Phosphorylation S1256 -1.072 -0.563 _REAALPPVS(ph)PLK_
EIF4G1 Phosphorylation S1263 0.713 0.836 _AALS(ph)EEELEKK_
FGFR1 Ubiquitylation K510 1.047 -0.221 _VTK(gl)VAVK_
FGFR3 Ubiquitylation K205 -0.115 _IGGIK(gl)LR_
FOXG1 Phosphorylation S6 0.325 0.055 _YS(ph)VSSPNSLGVVPYLGGEQSYYR_
FOXG1 Phosphorylation S235 -1.239 _TENGTCPS(ph)PPQPLS(ph)PAAALGSGSAAAVPK_
FOXG1 Phosphorylation S241 -1.239 _TENGTCPS(ph)PPQPLS(ph)PAAALGSGSAAAVPK_
FOXG1 Phosphorylation S259 -0.376 -0.198 _IES(ph)PDSSSSSLSSGSSPPGSLPSAR_
FOXG1 Phosphorylation S320 0.313 0.178 _GS(ph)PQSAAAELSSGLLASAAASSR_
FOXG1 Phosphorylation S323 0.347 _GSPQS(ph)AAAELSSGLLASAAASSR_
FOXG1 Ubiquitylation K554 -0.030 0.013 _TSGAFVYDCSK(gl)F_
FOXO3 Phosphorylation S12 -1.324 _(ac)AEAPASPAPLS(ph)PLEVELDPEFEPQSRPR_
FOXO3 Phosphorylation S253 2.510 _AVS(ph)MDNSNKYTK_
FOXO3 Phosphorylation S284 4.138 6.011 _AALQTAPESADDS(ph)PSQLSK_
FOXO3 Phosphorylation S421 1.295 _GS(ph)GLGSPTSSFNSTVFGPSSLNSLR_
FOXO3 Phosphorylation S425 1.471 _GSGLGS(ph)PTSSFNSTVFGPSSLNSLR_
GAB1 Phosphorylation S266 0.756 0.551 _SYS(ph)HDVLPK_
GAB1 Phosphorylation S367 0.230 0.176 _TAS(ph)DTDSSYCIPTAGMS(ph)PSR_
GAB1 Phosphorylation T369 -0.352 _TASDT(ph)DSSYCIPTAGMS(ph)PSR_
GAB1 Phosphorylation S381 -0.481 0.139 _TASDTDSSYCIPTAGM(ox)S(ph)PSR_
GAB1 Phosphorylation S401 0.266 0.788 _DAS(ph)SQDCYDIPR_
GAB1 Phosphorylation S402 0.328 0.633 _DASS(ph)QDCYDIPR_
GAB1 Phosphorylation S419 0.540 _SSS(ph)LEGFHNHFK_
GRB10 Phosphorylation S104 -0.985 -0.688 _SIQPQVS(ph)PR_
GRB2 Ubiquitylation K10 0.146 _YDFK(gl)ATADDELSFK_
GRB2 Ubiquitylation K20 -0.078 _ATADDELSFK(gl)R_
GRB2 Ubiquitylation K69 -0.362 0.641 _AK(gl)AEEMLSK_
GRB2 Ubiquitylation K76 0.754 _AEEMLSK(gl)QR_
GRB2 Ubiquitylation K109 0.381 -0.002 _FGNDVQHFK(gl)VLR_
GSK3A Phosphorylation S9 -0.483 0.010 _TTS(ph)FAESCKPVQQPSAFGSMK_
GSK3A Phosphorylation S21 -0.406 _TSS(ph)FAEPGGGGGGGGGGPGGSASGPGGTGGGK_
GSK3A Ubiquitylation K85 -0.204 _LCDSGELVAIK(gl)K_
GSK3A Ubiquitylation K86 -0.204 _LCDSGELVAIK(gl)K_
GSK3A Ubiquitylation K148 0.396 _ELVAIK(gl)K_
GSK3A Phosphorylation S215 0.296 0.477 _GEPNVS(ph)YICSR_
GSK3A Phosphorylation Y216 0.356 0.376 _GEPNVSY(ph)ICSR_
GSK3A Phosphorylation T390 2.800 2.527 _IQAAAST(ph)PTNATAASDANTGDR_
HRAS Ubiquitylation K170 -1.005 _K(gl)LNPPDESGPGCMSCK_
IDE Ubiquitylation K308 -0.121 0.325 _IVPIK(gl)DIR_
IGF1R Ubiquitylation K47 1.146 _NDYQQLK(gl)R_
IGF1R Ubiquitylation K1033 5.779 _VAIK(gl)TVNEAASMR_
IGF1R Ubiquitylation K1168 0.191 _K(gl)GGKGLLPVR_
IGF1R Ubiquitylation K1171 0.232 _GGK(gl)GLLPVR_
INSR Ubiquitylation K1022 -0.603 _EK(gl)ITLLR_
INSR Ubiquitylation K1047 0.305 0.711 _DIIK(gl)GEAETR_
INSR Ubiquitylation K1057 0.482 0.484 _VAVK(gl)TVNESASLR_
INSR Ubiquitylation K1352 1.606 2.754 _DGGSSLGFK(gl)R_
IRS1 Phosphorylation S1101 -0.078 _HSS(ph)ETFSSTPSATR_
IRS2 Phosphorylation S308 -0.079 -0.510 _SKS(ph)QSSGSSATHPISVPGAR_
IRS2 Phosphorylation T365 0.641 0.852 _T(ph)ASEGDGGAAAGAAAAGAR_
IRS2 Phosphorylation S367 0.757 0.612 _TAS(ph)EGDGGAAAGAAAAGAR_
IRS2 Phosphorylation S393 -1.580 -1.221 _PVSVAGSPLS(ph)PGPVR_
IRS2 Phosphorylation S520 0.359 -1.006 _S(ph)NTPESIAETPPAR_
IRS2 Phosphorylation T522 -1.103 -0.770 _SNT(ph)PESIAETPPAR_
IRS2 Phosphorylation T529 0.230 0.164 _S(ph)NTPESIAET(ph)PPAR_
IRS2 Phosphorylation S562 -0.026 0.439 _RVS(ph)GDAAQDLDR_
IRS2 Phosphorylation S579 0.542 0.362 _RTYS(ph)LTTPAR_
IRS2 Phosphorylation S621 -0.190 _LCPSCPAS(ph)SPK_
IRS2 Phosphorylation S622 -0.195 _LCPSCPASS(ph)PK_
IRS2 Phosphorylation S681 0.409 _SDDYM(ox)PM(ox)S(ph)PASVSAPK_
IRS2 Phosphorylation S732 -1.089 _AS(ph)SPAESSPEDSGYM(ox)R_
IRS2 Phosphorylation S733 -1.027 0.522 _ASS(ph)PAESSPEDSGYM(ox)R_
IRS2 Phosphorylation S738 0.522 _ASS(ph)PAESS(ph)PEDSGYMR_
IRS2 Phosphorylation S917 -0.592 -1.025 _S(ph)PGEYINIDFGEPGAR_
IRS2 Phosphorylation S1164 -0.499 _HSSETFSSTTTVTPVS(ph)PSFAHNPK_
IRS2 Phosphorylation S1178 0.766 0.277 _HNSAS(ph)VENVSLR_
IRS2 Phosphorylation T1204 -0.454 _SSEGGVGVGPGGGDEPPT(ph)SPR_
IRS2 Phosphorylation S1205 -0.291 _SSEGGVGVGPGGGDEPPTS(ph)PR_
KRAS Ubiquitylation K128 1.528 1.433 _TVDTK(gl)QAHELAK_
KRAS Ubiquitylation K235 0.591 0.087 _TVDTK(gl)QAQDLAR_
KRAS Ubiquitylation K254 -0.450 -0.156 _SYGIPFIETSAK(gl)TR_
MAP2K1 Ubiquitylation K192 -0.205 -0.241 _DVK(gl)PSNILVNSR_
MAP2K1 Phosphorylation S385 0.066 _RSDAEEVDFAGWLCSTIGLNQPS(ph)TPTHAAGV_
MAP2K1 Phosphorylation T386 0.377 _RSDAEEVDFAGWLCSTIGLNQPST(ph)PTHAAGV_
MAP2K2 Phosphorylation S23 0.873 0.258 _RKPVLPALTINPTIAEGPS(ph)PTSEGASEANLVDLQK_
MAP2K2 Phosphorylation T25 0.439 _RKPVLPALTINPTIAEGPSPT(ph)SEGASEANLVDLQK_
MAP2K2 Ubiquitylation K192 -0.205 -0.241 _DVK(gl)PSNILVNSR_
MAP2K2 Phosphorylation S293 -0.361 _ELEAIFGRPVVDGEEGEPHS(ph)ISPR_
MAP2K2 Phosphorylation S295 -0.234 0.026 _ELEAIFGRPVVDGEEGEPHSIS(ph)PR_
MAP2K2 Phosphorylation T394 0.570 0.158 _LNQPGT(ph)PTR_
MAPK3 Phosphorylation Y204 -0.807 -2.487 _IADPEHDHTGFLTEY(ph)VATR_
MAPK3 Ubiquitylation K289 -0.608 _NYLQSLPSKTK(gl)_
MLST8 Phosphorylation T3 -0.481 _(ac)MNT(ph)SPGTVGSDPVILATAGYDHTVR_
MLST8 Ubiquitylation K245 -0.114 0.462 _FSPDSTLLATCSADQTCK(gl)IWR_
MTOR Ubiquitylation K309 -0.762 0.065 _DLMGFGTK(gl)PR_
MTOR Ubiquitylation K1257 -1.167 -0.901 _SGQGDALASGPVETGPMKK(gl)_
MTOR Ubiquitylation K1395 -1.255 _AYAK(gl)ALHYK_
MTOR Ubiquitylation K2066 -1.004 _GPQTLK(gl)ETSFNQAYGR_
MTOR Ubiquitylation K2166 -1.304 _IQSIAPSLQVITSK(gl)QRPR_
MTOR Phosphorylation T2471 0.329 _KT(ph)GTTVPESIHSFIGDGLVKPEALNK_
NRAS Ubiquitylation K128 1.528 1.433 _TVDTK(gl)QAHELAK_
PDK2 Ubiquitylation K376 -0.374 _LPVYNK(gl)SAWR_
PDPK1 Phosphorylation S241 0.358 0.361 _ANS(ph)FVGTAQYVSPELLTEK_
PDPK1 Ubiquitylation K257 0.571 -0.234 _ANSFVGTAQYVSPELLTEK(gl)SACK_
PHIP Ubiquitylation K6 1.214 _K(gl)GLSELR_
PHIP Ubiquitylation K65 0.460 _TYQNLVK(gl)YYR_
PHIP Phosphorylation S674 0.709 0.567 _LSRGS(ph)ISSTSEVHSPPNVGLR_
PHIP Ubiquitylation K767 0.459 _ENK(gl)IPTVSK_
PHIP Phosphorylation S911 0.029 -0.103 _VNEEKDGPIS(ph)PKK_
PHIP Ubiquitylation K1005 0.642 _EQELMK(gl)IVGIK_
PHIP Ubiquitylation K1032 -0.023 _LAFLDPDTGK(gl)LTGGSFTMK_
PHIP Ubiquitylation K1062 1.216 0.801 _QQFDDAK(gl)YRR_
PHIP Phosphorylation S1315 2.743 1.429 _AQS(ph)YDIQAWKK_
PHIP Ubiquitylation K1383 -0.669 _ETLEAGNYESPMELCK(gl)DVR_
PHIP Phosphorylation S1525 -0.688 _VVVDPVVTEQPSTSS(ph)AAK_
PHIP Ubiquitylation K1528 -0.207 _VVVDPVVTEQPSTSSAAK(gl)TFITK_
PHIP Ubiquitylation K1533 1.039 _TFITK(gl)ANASAIPGK_
PHIP Phosphorylation S1560 -0.176 0.420 _ALNTLSS(ph)PGQSSFSHGTR_
PHIP Ubiquitylation K1602 1.984 _ASTLSK(gl)SSAVIEQGDCK_
PHIP Phosphorylation S1651 -0.008 _VEVNTNS(ph)GEIIHK_
PHIP Phosphorylation S1783 0.754 0.729 _TAFYNEDDS(ph)EEEQR_
PHIP Ubiquitylation K1815 1.427 0.364 _AK(gl)ANLIGW_
PIK3C2A Ubiquitylation K11 -1.238 -0.061 _(ac)AQISSNSGFK(gl)ECPSSHPEPTR_
PIK3C2A Ubiquitylation K112 -0.649 _LLLDDSFETK(gl)K_
PIK3C2A Ubiquitylation K113 -0.649 _LLLDDSFETK(gl)K_
PIK3C2A Phosphorylation S259 1.013 0.488 _VSNLQVS(ph)PK_
PIK3C2A Phosphorylation S338 0.437 0.685 _SQS(ph)LNIR_
PIK3C2A Ubiquitylation K674 -0.351 _SPTDCAQSSK(gl)SVK_
PIK3C2A Phosphorylation S1553 0.393 0.261 _SADAGSFS(ph)PTPGQIGGAVK_
PIK3C3 Ubiquitylation K29 0.271 _IGSLEGK(gl)R_
PIK3C3 Ubiquitylation K158 -1.333 _VWPNVEADGSEPTK(gl)TPGR_
PIK3C3 Ubiquitylation K209 -1.012 _EIEMINESEK(gl)R_
PIK3C3 Ubiquitylation K287 -1.261 _SGPSDHDLK(gl)PNAATR_
PIK3CA Ubiquitylation K864 0.390 0.588 _NSHTIM(ox)QIQCK(gl)GGLK_
PIK3CA Ubiquitylation K868 0.204 0.651 _NSHTIM(ox)QIQCKGGLK(gl)_
PIK3CA Ubiquitylation K974 -0.273 _GAQECTK(gl)TREFER_
PIK3CB Ubiquitylation K1044 0.990 _SEEEALKQFKQK(gl)_
PIK3R2 Phosphorylation S262 -2.237 _APPPPS(ph)SPPPGGAPDGSEPSPDFPALLVEK_
PIK3R2 Phosphorylation S263 -2.237 _APPPPS(ph)SPPPGGAPDGSEPSPDFPALLVEK_
PIK3R2 Ubiquitylation K500 -0.189 _IFEEQGQTQEK(gl)CSK_
PIK3R2 Ubiquitylation K541 -0.609 _TK(gl)LEQQLR_
PIK3R2 Ubiquitylation K564 -0.431 -1.022 _MNSLK(gl)PDLMQLR_
PIK3R3 Ubiquitylation K226 -0.376 _YQQDQLVKEDNIDAVGKK(gl)_
PIK3R3 Ubiquitylation K320 0.385 _LGEIHDSK(gl)MR_
PPM1A Ubiquitylation K278 -0.176 _VCNEVVDTCLYK(gl)GSR_
PRKAA1 Ubiquitylation K271 -0.536 _ATIK(gl)DIR_
PRKAA1 Ubiquitylation K396 -0.419 _HTLDELNPQK(gl)SK_
PRKAA1 Ubiquitylation K485 -1.326 -1.554 _SIDDEITEAK(gl)SGTATPQR_
PRKAA2 Ubiquitylation K271 -0.536 _ATIK(gl)DIR_
PRKAA2 Phosphorylation S377 -0.020 _MPPLIADS(ph)PK_
PRKAB1 Phosphorylation S108 -0.357 0.129 _S(ph)HNNFVAILDLPEGEHQYK_
PRKAG1 Ubiquitylation K78 -0.588 _AAPLWDSK(gl)K_
PRKAG1 Ubiquitylation K79 -0.588 _AAPLWDSK(gl)K_
PRKAG1 Ubiquitylation K243 -0.525 -0.505 _VSALPVVDEK(gl)GR_
PRKAG2 Ubiquitylation K78 -0.588 _AAPLWDSK(gl)K_
PRKAG2 Ubiquitylation K79 -0.588 _AAPLWDSK(gl)K_
PRKAG2 Ubiquitylation K243 -0.525 -0.505 _VSALPVVDEK(gl)GR_
PRKCZ Phosphorylation T560 -0.884 -1.578 _KQALPPFQPQITDDYGLDNFDTQFTSEPVQLT(ph)PDDEDAIKR_
PTPN1 Phosphorylation S352 0.032 _GS(ph)PLNAAPYGIESMSQDTEVR_
PTPN1 Phosphorylation S365 -0.247 0.956 _GSPLNAAPYGIESMS(ph)QDTEVR_
PTPN1 Phosphorylation S378 1.462 1.262 _VVGGS(ph)LR_
PTPN11 Ubiquitylation K124 0.562 _EAEK(gl)LLTEK_
PTPN2 Phosphorylation S304 -0.873 -0.641 _ELSKEDLSPAFDHS(ph)PNK_
PTPRA Ubiquitylation K571 -0.065 _TGNLPANMK(gl)K_
PTPRA Ubiquitylation K572 0.007 -0.015 _TGNLPANMKK(gl)_
RAF1 Phosphorylation S29 0.028 -0.571 _DAVFDGSSCIS(ph)PTIVQQFGYQR_
RAF1 Phosphorylation T31 0.028 -0.669 _DAVFDGSSCIS(ph)PTIVQQFGYQR_
RAF1 Phosphorylation S244 0.053 _YSTPHAFTFNTSS(ph)PSSEGSLSQR_
RAF1 Phosphorylation S259 -0.069 0.054 _STS(ph)TPNVHM(ox)VSTTLPVDSR_
RAF1 Phosphorylation S301 -0.651 _SHSESASPSALSSSPNNLS(ph)PTGWSQPK_
RAF1 Phosphorylation T303 -0.664 _SHSESASPSALSSSPNNLSPT(ph)GWSQPK_
RAF1 Phosphorylation S497 -0.449 _SRWS(ph)GSQQVEQPTGSVLWMAPEVIR_
RAF1 Phosphorylation S621 0.212 0.271 _SAS(ph)EPSLHR_
RAF1 Phosphorylation S642 -0.197 0.463 _AAHTEDINACTLTTS(ph)PR_
RHEB Ubiquitylation K121 -0.852 _VQIPIMLVGNKK(gl)_
RHOQ Ubiquitylation K115 -1.745 -0.215 _AK(gl)WYPEVR_
RHOQ Ubiquitylation K139 0.125 _LNDMK(gl)EKPICVEQGQK_
RHOQ Ubiquitylation K141 0.125 _LNDMK(gl)EKPICVEQGQK_
RHOQ Ubiquitylation K142 0.492 _LDLRDDK(gl)DTIEK_
RHOQ Ubiquitylation K152 0.099 -0.292 _K(gl)LTPITYPQGLAMAK_
RHOQ Ubiquitylation K166 -0.981 -0.655 _LTPITYPQGLAMAK(gl)EIGAVK_
RHOQ Ubiquitylation K172 1.026 0.412 _EIGAVK(gl)YLECSALTQR_
RHOQ Ubiquitylation K185 -0.113 0.578 _GLK(gl)TVFDEAIR_
RHOQ Ubiquitylation K202 -1.379 -1.447 _AVLCPPPVK(gl)KR_
RHOQ Ubiquitylation K203 -1.708 -1.447 _AVLCPPPVKK(gl)_
RPS6 Ubiquitylation K58 2.088 1.670 _ISGGNDK(gl)QGFPMK_
RPS6 Phosphorylation S235 2.968 _LS(ph)SLRAS(ph)TSK_
RPS6 Phosphorylation S236 2.333 3.174 _LSS(ph)LRAS(ph)TSK_
RPS6 Phosphorylation S240 2.384 2.672 _LSSLRAS(ph)TSK_
RPS6 Phosphorylation T241 3.252 3.164 _LSS(ph)LRAST(ph)SK_
RPS6KB1 Ubiquitylation K99 -0.316 _VLGK(gl)GGYGK_
RPS6KB1 Phosphorylation S447 -0.525 -0.458 _TPVS(ph)PVKFSPGDFWGR_
RPTOR Phosphorylation S722 0.393 1.196 _SVSS(ph)YGNIR_
RPTOR Phosphorylation T857 -0.348 _VLDTSSLT(ph)QSAPAS(ph)PTNK_
RPTOR Phosphorylation S859 -0.462 -0.346 _VLDTSSLTQS(ph)APASPT(ph)NK_
RPTOR Phosphorylation S863 -0.208 -0.001 _VLDTSSLTQS(ph)APAS(ph)PTNK_
RPTOR Phosphorylation T865 -0.317 _VLDTSSLTQS(ph)APASPT(ph)NK_
RPTOR Phosphorylation S877 -0.114 -0.074 _GVHIHQAGGS(ph)PPASSTSSSSLTNDVAK_
RPTOR Ubiquitylation K1008 -0.329 _QAQQVIQK(gl)GITR_
SMARCC1 Phosphorylation S310 -0.047 0.123 _NEEPVRS(ph)PERR_
SMARCC1 Phosphorylation S328 -0.755 -0.358 _KHS(ph)PS(ph)PPPPTPTESR_
SMARCC1 Phosphorylation S330 -0.755 -1.491 _KHS(ph)PS(ph)PPPPTPTESR_
SMARCC1 Ubiquitylation K588 -0.831 _SPQVPAAQQMLNFPEK(gl)NK_
SMARCC1 Ubiquitylation K590 -0.737 _NK(gl)EKPVDLQNFGLR_
SMARCC1 Ubiquitylation K592 -0.509 _EK(gl)PVDLQNFGLR_
SMARCC1 Ubiquitylation K608 -0.342 0.588 _TDIYSK(gl)K_
SMARCC1 Ubiquitylation K609 -0.053 0.520 _TDIYSKK(gl)_
SMARCC1 Ubiquitylation K716 0.001 _VASAAAK(gl)AALEEFSR_
SMARCC1 Ubiquitylation K882 0.402 _AK(gl)HLAAVEER_
SORBS1 Phosphorylation S57 -0.823 0.018 _ETPSSSPAS(ph)PQETR_
SORBS1 Phosphorylation S548 -0.502 -0.518 _RVGEQDSAPTQEKPTS(ph)PGK_
SOS1 Phosphorylation S1082 0.278 _IPESETESTASAPNS(ph)PR_
SOS1 Phosphorylation S1166 0.097 -0.094 _RPESAPAES(ph)SPSK_
SREBF1 Ubiquitylation K321 -0.637 _LAAGSK(gl)APASAQSR_
SREBF1 Ubiquitylation K579 -1.649 0.673 _K(gl)QADLDLAR_
STK11 Phosphorylation S31 0.437 0.073 _IDS(ph)TEVIYQPR_
STK11 Phosphorylation T32 1.256 0.248 _IDS(ph)TEVIYQPR_
STRADA Ubiquitylation K7 -0.518 _(ac)SFLVSK(gl)PER_
STXBP4 Phosphorylation S6 0.972 _(ac)MNKNTS(ph)TVVSPS(ph)LLEK_
STXBP4 Ubiquitylation K487 -0.179 _ELVK(gl)SVR_
TSC1 Phosphorylation S505 0.141 0.350 _GGFDS(ph)PFYR_
TSC2 Ubiquitylation K3 -1.397 _(ac)AK(gl)PTSKDSGLK_
TSC2 Ubiquitylation K14 -1.297 _DSGLKEK(gl)FK_
TSC2 Ubiquitylation K69 0.051 _MIGQICEVAK(gl)TK_
TSC2 Ubiquitylation K71 -0.157 _MIGQICEVAKTK(gl)_
TSC2 Ubiquitylation K258 -0.278 _ELCEPCWK(gl)LMR_
TSC2 Ubiquitylation K634 1.610 _LGLPNK(gl)DGVVR_
TSC2 Phosphorylation S950 -0.152 -0.529 _STS(ph)LNERPK_
TSC2 Phosphorylation S1064 -0.927 _SLLGLDSGELQSGPESSSS(ph)PGVHVR_
TSC2 Phosphorylation S1248 -0.604 _SNTDSAVVMEEGS(ph)PGEVPVLVEPPGLEDVEAALGMDRR_
TSC2 Phosphorylation S1329 -0.120 _S(ph)SSSPELQTLQDILGDPGDK_
TSC2 Phosphorylation S1331 -0.262 _SSS(ph)SPELQTLQDILGDPGDKADVGR_
TSC2 Phosphorylation S1332 -0.063 _SSSS(ph)PELQTLQDILGDPGDK_
TSC2 Phosphorylation S1355 0.174 0.351 _ADVGRLS(ph)PEVK_
TSC2 Phosphorylation S1362 0.859 _S(ph)QSGTLDGESAAWSASGEDSR_
TSC2 Phosphorylation S1364 0.522 0.550 _SQS(ph)GTLDGESAAWSASGEDSR_
TSC2 Phosphorylation T1366 0.137 _SQSGT(ph)LDGESAAWSASGEDSR_
TSC2 Phosphorylation S1396 0.498 _S(ph)PSGLRPR_
TSC2 Phosphorylation S1743 0.596 _RLISS(ph)VEDFTEFV_
YWHAB Ubiquitylation K11 1.057 1.322 _(ac)TMDKSELVQK(gl)AK_
YWHAB Ubiquitylation K13 0.060 0.388 _AK(gl)LAEQAER_
YWHAB Ubiquitylation K70 0.558 -0.175 _VISSIEQK(gl)TER_
YWHAB Ubiquitylation K140 0.531 _YLSEVASGDNK(gl)QTTVSNSQQAYQEAFEISKK_
YWHAB Ubiquitylation K159 0.300 _QTTVSNSQQAYQEAFEISK(gl)K_
YWHAB Ubiquitylation K160 -0.439 -0.371 _K(gl)EMQPTHPIR_
ZNF106 Phosphorylation T394 -0.139 _SEMIEKPLFDFSLITTGIQEPQT(ph)DETRNSPTQK_
ZNF106 Phosphorylation S400 -0.395 _SEMIEKPLFDFSLITTGIQEPQTDETRNS(ph)PTQK_
ZNF106 Phosphorylation T640 -0.033 _ELST(ph)SPCNPIVR_
ZNF106 Phosphorylation S641 -0.004 -0.206 _ELSTS(ph)PCNPIVR_
ZNF106 Phosphorylation S861 0.371 0.480 _SLS(ph)ESSVIMDR_
ZNF106 Phosphorylation S1025 -1.054 -0.828 _ATGDGS(ph)SPELPSLER_
ZNF106 Phosphorylation S1026 -1.128 -1.348 _ATGDGSS(ph)PELPSLER_
ZNF106 Phosphorylation S1279 0.584 0.203 _NRENS(ph)PSSQSAGLSSINK_
ZNF106 Phosphorylation S1328 -0.439 -0.804 _EPHS(ph)PADQPEQQAESTLTSAETR_
ZNF106 Phosphorylation S1370 -0.198 -0.188 _AAHVPENS(ph)DTEQDVLTVKPVR_
ZNF106 Phosphorylation T1372 0.023 _AAHVPENSDT(ph)EQDVLTVKPVR_
ZNF106 Phosphorylation S1560 0.143 -0.034 _TVRVYNLVS(ph)R_


.

© Copyright Svejstrup Laboratory 2015