bioLOGIC Data » bioLOGIC CategoryView » bioLOGIC VennView » Experimental Details »

bioLOGIC Category

Results for the Category
KEGG_INSULIN_SIGNALING_PATHWAY
(Pathway_44)

RNAi screen result RNAPII IP (MG132) CSB IP CSB IP (MG132) Chrom. Chrom. (MG132) Ubi /Phospo Ubi /Phospho (MG132)
W

Protein Results:

 Results for post-translational modifications (below)
Gene name MGoogle Score RNAi high RNAi low RNAPII-IP (MG132) CSB-IP CSB-IP (MG132) Chrom. Chrom. (MG132)
RPS6 5 -1.590 2.890 0.202 -0.347 -0.009 -0.153 0.152
PCK1 3 -0.250 0.020
PCK1 3 -0.250 0.020 -0.618 1.207 -2.619 1.882 1.706
PPP1CA 3 2.150 -0.860
PPP1CA 3 2.150 -0.860 -0.250 0.634 0.981 -0.108 0.171
GSK3B 2 1.020 -0.870 -1.128 1.091
PCK2 2 0.680 -0.790 -0.618 1.207 -2.619 1.882 1.706
AKT3 2 0.580 -0.030 -0.194
AKT3 2 0.580 -0.030
INSR 2 -0.850 0.830 1.143 0.785
PPP1CC 2 0.390 -0.090
PPP1CC 2 0.390 -0.090 0.568 0.526 0.917 -0.533 0.173
PPP1CB 2 -0.790 1.500
PPP1CB 2 -0.790 1.500 0.568 0.526 0.917 -0.533 0.173
PPP1CB 2 -0.790 1.500 0.439 0.908 1.224 -0.104 0.029
MAPK9 1 0.110 -0.490
PYGL 1 0.220 -0.250
PYGL 1 0.220 -0.250 1.354 1.739
PYGL 1 0.220 -0.250 -2.175 -0.336
TSC2 1 0.810 -0.710
TSC2 1 0.810 -0.710 -0.715
PIK3R2 1 2.740 -1.180 0.269 0.348
RHEB 1 2.630 -1.320 0.991 -0.417
PRKAR1A 1 -0.550 0.230
PRKAR1A 1 -0.550 0.230
RAF1 1 2.020 -1.230
KRAS 1 -0.510 0.620 1.031 0.887
KRAS 1 -0.510 0.620 0.246 -0.346
FLOT1 1 -1.430 2.490 0.836 0.238
CALM2 1 -0.690 0.700 1.911
CALM2 1 -0.690 0.700 0.877 -4.680
EIF4E 1 -2.250 4.200 0.590 0.156
EIF4E 1 -2.250 4.200 0.369
HK1 1 0.220 -0.690 1.567 -1.654 0.693 0.567
HK1 1 0.220 -0.690 -0.135
CALM3 1 -0.190 0.120 1.911
CALM3 1 -0.190 0.120 0.877 -4.680
MAP2K1 1 -1.590 2.780
EIF4EBP1 1 2.050 -1.320
PRKAR1B 1 0.660 -0.470
PRKAR1B 1 0.660 -0.470
CALM1 1 -0.440 0.360 1.911
CALM1 1 -0.440 0.360 0.877 -4.680
NRAS 1 1.810 -0.720 0.246 -0.346
BAD 0 -0.660 1.190
PRKAR2B 0 -0.290 0.380
PHKA2 0 -0.110 0.540
PIK3CB 0 -1.390 2.350
PIK3CB 0 -0.710 1.450
PRKCZ 0 -0.290 0.310
PYGM 0 0.850 -0.720 -2.175 -0.336
PRKACA 0 0.380 -0.680 -1.005 -0.697 0.234 0.487
SREBF1 0 0.540 -0.490
SREBF1 0 0.540 -0.490
ARAF 0 0.550 -0.670
ARAF 0 0.550 -0.670
LIPE 0 0.910 -0.460 -0.066
SORBS1 0 0.660 -0.330
CRKL 0 0.290 -0.620
PYGB 0 1.080 -0.830
PYGB 0 1.080 -0.830 -2.175 -0.336
MAPK3 0
PHKB 0 -0.400 0.270
PHKB 0 -0.400 0.270 -2.570
IKBKB 0 0.400 0.610
GYS1 0 1.000 -0.130 -0.800 0.561 0.380
AKT2 0 -1.420 2.210 -0.194
PRKAG2 0 1.300 -0.990 0.278 -0.667
RAPGEF1 0 1.620 -0.780
RPS6KB1 0 0.850 -0.600
PRKAB1 0 0.640 -1.180
PRKAR2A 0 -0.530 1.080 0.026 -1.317 -0.866 0.783 0.007
PRKAR2A 0 -0.530 1.080
SOS1 0 0.500 -0.620 -0.570
PIK3R3 0 -0.140 -0.480
PIK3R3 0 -0.140 -0.480 -0.441 0.147
RHOQ 0 0.310 -0.560 0.486 -0.364 -0.568
RHOQ 0 1.120 -0.210 0.486 -0.364 -0.568
RHOQ 0 0.310 -0.560
RHOQ 0 1.120 -0.210
PIK3CA 0
TRIP10 0 0.140 -0.170
ELK1 0
MAP2K2 0 -0.610 0.080
MAP2K2 0 -0.610 0.080
PRKAA1 0 0.910 0.060
INPP5K 0 -0.690 1.160
FLOT2 0 -0.080 0.520 -0.953 0.204 0.290
IRS4 0 -0.240 -0.060 -0.868 -1.279 -1.308 -0.107 0.122
EIF4E2 0 0.840 -0.580 -0.233 -0.963
PDPK1 0 0.050 -0.440
RPTOR 0 0.520 -1.030 0.623 0.466
AKT1 0 -0.050 0.700
AKT1 0 0.860 -0.040
PRKACB 0 1.740 -1.200 -1.064
PRKACB 0 1.740 -1.200 -1.005 -0.697 0.234 0.487
PTPRF 0 1.070 -0.360 -0.194 0.365
PIK3R1 0 1.910 -1.220 -0.441 0.147
PHKG2 0 -0.370 -0.400
PHKG2 0 -0.350 -0.370
BRAF 0
HK2 0 0.400 0.360 -0.317 0.133 -0.115
HK3 0 0.440 -0.920 -0.317 0.133 -0.115
PRKAA2 0 -0.030 -0.350
PRKAA2 0 -0.030 -0.350
PRKCI 0 0.730 -0.460 1.483 0.192 0.350
TSC1 0 1.100 -0.150
CRK 0 -0.790 0.230
IRS1 0
FASN 0 -0.350 -0.530 -0.550 -0.478 -0.892 -0.134 0.004
HRAS 0 1.470 -0.520
RPS6KB2 0 -1.260 2.030
EIF4E1B 0 1.610 -1.080 0.590 0.156
GRB2 0 -0.240 0.300 -1.021 0.057 0.906
CALML3 0 0.460 -0.670
CALML5 0 -0.980 1.530
PRKAG1 0 0.400 -0.420 0.278 -0.667
EXOC7 0 -0.770 0.320 0.252 0.137
EXOC7 0 0.850 -0.370 0.252 0.137
IRS2 0 -0.190 -0.130
PTPN1 0 -0.150 0.310 1.066 0.459 0.251 0.322 0.379
MTOR 0 -0.680 0.150 0.757 0.074 0.101

PTM Sites:

 Back to Protein Results
Gene name PTM type PTM site UV UV (MG132) Sequence
AKT1 Phosphorylation S124 0.252 0.311 _SGS(ph)PSDNSGAEEMEVSLAKPK_
AKT1 Phosphorylation S126 -0.241 _SGSPS(ph)DNSGAEEM(ox)EVSLAK_
AKT1 Ubiquitylation K301 0.988 _EGIK(gl)DGATMK_
AKT2 Ubiquitylation K14 0.306 0.070 _EGWLHK(gl)R_
AKT2 Ubiquitylation K111 1.082 _AIQMVANSLK(gl)QR_
AKT2 Ubiquitylation K160 0.251 _LLGK(gl)GTFGK_
AKT2 Phosphorylation T451 -0.091 -0.612 _YFDDEFTAQSITIT(ph)PPDRYDSLGLLELDQR_
AKT2 Phosphorylation Y456 -0.265 _YFDDEFTAQSITITPPDRY(ph)DSLGLLELDQR_
AKT3 Ubiquitylation K14 0.306 0.070 _EGWLHK(gl)R_
AKT3 Ubiquitylation K14 4.941 5.277 _EGWVQK(gl)R_
AKT3 Ubiquitylation K111 1.082 _AIQMVANSLK(gl)QR_
AKT3 Phosphorylation S120 1.097 _MNCS(ph)PTSQIDNIGEEEMDASTTHHK_
AKT3 Ubiquitylation K160 0.251 _LLGK(gl)GTFGK_
AKT3 Phosphorylation T451 -0.091 -0.612 _YFDDEFTAQSITIT(ph)PPDRYDSLGLLELDQR_
AKT3 Phosphorylation Y456 -0.265 _YFDDEFTAQSITITPPDRY(ph)DSLGLLELDQR_
ARAF Phosphorylation T227 0.017 _STSTPNVHMVSTT(ph)APMDSNLIQLTGQSFSTDAAGSR_
ARAF Phosphorylation S260 0.245 _GS(ph)PSPASVSSGR_
ARAF Ubiquitylation K543 -1.068 -0.962 _ISSNCPK(gl)AMR_
ARAF Phosphorylation S621 0.212 0.271 _SAS(ph)EPSLHR_
BAD Phosphorylation S74 -0.904 -0.452 _HS(ph)SYPAGTEDDEGM(ox)GEEPSPFR_
BAD Phosphorylation S75 -0.914 -0.660 _HSS(ph)YPAGTEDDEGMGEEPSPFR_
BAD Phosphorylation S97 0.056 _S(ph)RSAPPNLWAAQR_
BAD Phosphorylation S99 -0.299 0.161 _S(ph)APPNLWAAQR_
BAD Phosphorylation S118 1.277 1.089 _RM(ox)S(ph)DEFVDSFKK_
BRAF Phosphorylation S151 -0.685 -0.629 _SNPKS(ph)PQKPIVR_
BRAF Phosphorylation S363 -0.023 -0.241 _S(ph)SSAPNVHINTIEPVNIDDLIR_
BRAF Phosphorylation S365 -0.286 0.012 _SSS(ph)APNVHINTIEPVNIDDLIR_
BRAF Phosphorylation S399 -0.890 -0.527 _GDGGSTTGLS(ph)ATPPASLPGSLTNVK_
BRAF Phosphorylation T401 -0.525 _GDGGSTTGLSAT(ph)PPASLPGSLTNVK_
BRAF Phosphorylation S446 0.246 0.349 _RDS(ph)SDDWEIPDGQITVGQR_
BRAF Phosphorylation S447 0.579 0.623 _RDSS(ph)DDWEIPDGQITVGQR_
BRAF Phosphorylation S729 0.208 0.219 _SAS(ph)EPSLNR_
CALM1 Ubiquitylation K78 0.061 _DGDGTITTK(gl)ELGTVMR_
CALM1 Ubiquitylation K142 0.922 _VFDK(gl)DGNGYISAAELR_
CALM2 Ubiquitylation K78 0.061 _DGDGTITTK(gl)ELGTVMR_
CALM2 Ubiquitylation K142 0.922 _VFDK(gl)DGNGYISAAELR_
CALM3 Ubiquitylation K78 0.061 _DGDGTITTK(gl)ELGTVMR_
CALM3 Ubiquitylation K142 0.922 _VFDK(gl)DGNGYISAAELR_
CRK Phosphorylation S40 0.533 0.363 _DS(ph)STSPGDYVLSVSENSR_
CRK Phosphorylation S41 1.065 0.801 _DSS(ph)TSPGDYVLSVSENSR_
CRKL Phosphorylation S41 0.868 _DS(ph)STCPGDYVLSVSENSR_
CRKL Phosphorylation S107 -0.818 -1.177 _YPS(ph)PPMGSVSAPNLPTAEDNLEYVR_
EIF4E Ubiquitylation K147 -0.433 0.065 _WLITLNK(gl)QQR_
EIF4E1B Ubiquitylation K147 -0.433 0.065 _WLITLNK(gl)QQR_
EIF4EBP1 Phosphorylation Y34 -1.060 _RVVLGDGVQLPPGDY(ph)STTPGGTLFS(ph)TTPGGTR_
EIF4EBP1 Phosphorylation S35 -0.849 _RVVLGDGVQLPPGDYS(ph)TTPGGTLFS(ph)TTPGGTR_
EIF4EBP1 Phosphorylation T37 -0.768 -0.583 _RVVLGDGVQLPPGDYSTT(ph)PGGTLFSTT(ph)PGGTR_
EIF4EBP1 Phosphorylation T41 -3.655 -0.903 _RVVLGDGVQLPPGDYST(ph)TPGGT(ph)LFSTTPGGTR_
EIF4EBP1 Phosphorylation S44 -0.796 _VVLGDGVQLPPGDYSTTPGGTLFS(ph)T(ph)TPGGTR_
EIF4EBP1 Phosphorylation T45 -0.727 _VVLGDGVQLPPGDYSTTPGGTLFS(ph)T(ph)TPGGTR_
EIF4EBP1 Phosphorylation T46 -0.890 -0.817 _RVVLGDGVQLPPGDYSTT(ph)PGGTLFSTT(ph)PGGTR_
EIF4EBP1 Phosphorylation S65 0.522 0.478 _NS(ph)PVTKT(ph)PPR_
EIF4EBP1 Phosphorylation T68 -1.621 -2.402 _NS(ph)PVT(ph)KTPPRDLPTIPGVTSPSSDEPPMEASQSHLR_
EIF4EBP1 Ubiquitylation K69 -1.171 -1.547 _NSPVTK(gl)TPPR_
EIF4EBP1 Phosphorylation T70 -0.702 -0.017 _NSPVTKT(ph)PPR_
EIF4EBP1 Phosphorylation T77 -1.921 -1.898 _TPPRDLPT(ph)IPGVTSPSSDEPPMEASQSHLR_
EIF4EBP1 Phosphorylation T82 1.253 _DLPTIPGVT(ph)SPSSDEPPMEASQSHLR_
EIF4EBP1 Phosphorylation S83 1.211 0.339 _DLPTIPGVTS(ph)PSSDEPPMEASQSHLR_
EIF4EBP1 Phosphorylation S96 -1.541 _DLPTIPGVTSPSSDEPPMEASQS(ph)HLRNSPEDK_
EIF4EBP1 Phosphorylation S101 -1.900 -1.976 _DLPTIPGVTSPSSDEPPMEASQSHLRNS(ph)PEDK_
ELK1 Phosphorylation S273 -0.601 -0.553 _PAVVLPSAAPAGAAAPPS(ph)GSR_
ELK1 Phosphorylation S275 -0.601 -0.553 _PAVVLPSAAPAGAAAPPS(ph)GSR_
ELK1 Phosphorylation S403 0.568 -0.579 _DLELPLS(ph)PSLLGGPGPER_
FASN Ubiquitylation K41 -0.859 -0.543 _WK(gl)AGLYGLPR_
FASN Phosphorylation S207 0.105 0.507 _LGMLS(ph)PEGTCK_
FASN Ubiquitylation K213 -0.346 -0.011 _LGMLSPEGTCK(gl)AFDTAGNGYCR_
FASN Ubiquitylation K235 -0.149 0.117 _SEGVVAVLLTK(gl)K_
FASN Ubiquitylation K236 -0.149 -0.024 _SEGVVAVLLTKK(gl)_
FASN Ubiquitylation K326 0.372 _QEPLLIGSTK(gl)SNM(ox)GHPEPASGLAALAK_
FASN Ubiquitylation K436 -0.250 _TPEAVQK(gl)LLEQGLR_
FASN Ubiquitylation K528 -0.086 -0.587 _SDEAVK(gl)PFGLK_
FASN Ubiquitylation K673 0.201 0.234 _K(gl)EGVFAK(gl)EVR_
FASN Ubiquitylation K776 -1.050 _GLK(gl)PSCTIIPLMK_
FASN Phosphorylation S974 -1.491 -0.989 _LFDHPES(ph)PTPNPTEPLFLAQAEVYK_
FASN Phosphorylation T976 -1.624 -1.495 _LFDHPESPT(ph)PNPTEPLFLAQAEVYK_
FASN Phosphorylation S1028 0.133 -0.404 _DNWVS(ph)FM(ox)DTMLQMSILGSAK_
FASN Ubiquitylation K1065 -1.459 _QK(gl)LYTLQDK_
FASN Ubiquitylation K1072 0.386 0.144 _LYTLQDK(gl)AQVADVVVSR_
FASN Ubiquitylation K1142 0.056 0.226 _AALQEELQLCK(gl)GLVQALQTK_
FASN Ubiquitylation K1151 0.234 -0.094 _GLVQALQTK(gl)VTQQGLK_
FASN Ubiquitylation K1158 -0.496 -0.468 _VTQQGLK(gl)MVVPGLDGAQIPRDPSQQELPR_
FASN Ubiquitylation K1239 -0.362 _ACLDTAVENMPSLK(gl)MK_
FASN Ubiquitylation K1241 -0.510 -0.579 _ACLDTAVENMPSLKMK(gl)_
FASN Phosphorylation S1411 -0.978 _RPTPQDS(ph)PIFLPVDDTSFR_
FASN Ubiquitylation K1582 -1.228 -2.032 _DIMLATGK(gl)LSPDAIPGK_
FASN Ubiquitylation K1704 -0.247 _VFTTVGSAEK(gl)R_
FASN Ubiquitylation K1847 0.204 _YMAQGK(gl)HIGK_
FASN Ubiquitylation K1866 -1.615 -1.050 _VVVQVLAEEPEAVLK(gl)GAKPK_
FASN Ubiquitylation K1869 -0.967 _VVVQVLAEEPEAVLKGAK(gl)_
FASN Ubiquitylation K1871 -0.926 _GAK(gl)PKLM(ox)SAISK_
FASN Ubiquitylation K1878 0.194 -0.638 _LM(ox)SAISK(gl)TFCPAHK_
FASN Ubiquitylation K1911 -0.329 0.084 _GVQK(gl)LVLTSR_
FASN Ubiquitylation K1927 -0.254 -0.492 _TGYQAK(gl)QVR_
FASN Ubiquitylation K1993 -1.641 _DGLLENQTPEFFQDVCK(gl)PK_
FASN Phosphorylation S2198 -1.105 -1.296 _ADEAS(ph)ELACPT(ph)PK_
FASN Phosphorylation T2204 -0.587 -0.205 _ADEASELACPT(ph)PKEDGLAQQQTQLNLR_
FASN Ubiquitylation K2391 -0.844 -0.267 _VLEALLPLK(gl)GLEER_
FASN Ubiquitylation K2426 -0.591 0.390 _SFYYK(gl)LR_
FASN Ubiquitylation K2438 -0.623 -0.362 _AK(gl)YHGNVM(ox)LLR_
FASN Ubiquitylation K2449 -0.636 0.411 _AK(gl)TGGAYGEDLGADYNLSQVCDGK_
FLOT1 Ubiquitylation K78 0.615 0.585 _IQGQNK(gl)EMLAAACQMFLGK_
FLOT1 Phosphorylation S385 4.635 _ITLVSSGS(ph)GTM(ox)GAAK_
GRB2 Ubiquitylation K10 0.146 _YDFK(gl)ATADDELSFK_
GRB2 Ubiquitylation K20 -0.078 _ATADDELSFK(gl)R_
GRB2 Ubiquitylation K69 -0.362 0.641 _AK(gl)AEEMLSK_
GRB2 Ubiquitylation K76 0.754 _AEEMLSK(gl)QR_
GRB2 Ubiquitylation K109 0.381 -0.002 _FGNDVQHFK(gl)VLR_
GSK3B Phosphorylation S9 -0.483 0.010 _TTS(ph)FAESCKPVQQPSAFGSMK_
GSK3B Ubiquitylation K85 -0.204 _LCDSGELVAIK(gl)K_
GSK3B Ubiquitylation K86 -0.204 _LCDSGELVAIK(gl)K_
GSK3B Phosphorylation S215 0.296 0.477 _GEPNVS(ph)YICSR_
GSK3B Phosphorylation Y216 0.356 0.376 _GEPNVSY(ph)ICSR_
GSK3B Phosphorylation T390 2.800 2.527 _IQAAAST(ph)PTNATAASDANTGDR_
GYS1 Ubiquitylation K88 -1.746 -1.039 _TQVELLEAPTPALK(gl)R_
GYS1 Ubiquitylation K381 -0.746 -0.708 _TNNFNVETLK(gl)GQAVR_
GYS1 Phosphorylation S727 0.148 -0.041 _RNSVDTATSSSLSTPSEPLS(ph)PTSSLGEERN_
HK1 Ubiquitylation K347 0.276 _LILVK(gl)MAK_
HK1 Ubiquitylation K368 0.598 0.758 _GK(gl)FNTSDVSAIEK_
HK1 Ubiquitylation K453 -0.246 _TTVGVDGSLYK(gl)THPQYSR_
HK1 Ubiquitylation K524 0.164 0.370 _DMLLEVKK(gl)_
HK1 Ubiquitylation K798 0.769 _NILIDFTK(gl)K_
HK1 Ubiquitylation K799 0.924 _NILIDFTKK(gl)_
HK1 Ubiquitylation K920 -0.244 -0.335 _ELSPK(gl)CNVSFLLSEDGSGK_
HK2 Ubiquitylation K346 -0.340 _DISDIEGEK(gl)DGIRK_
HK2 Ubiquitylation K419 0.385 _STIGVDGSVYKK(gl)_
HK2 Ubiquitylation K451 -0.118 _SEDGSGK(gl)GAAMVTAVAYR_
HK3 Ubiquitylation K346 -0.340 _DISDIEGEK(gl)DGIRK_
HK3 Ubiquitylation K419 0.385 _STIGVDGSVYKK(gl)_
HK3 Ubiquitylation K451 -0.118 _SEDGSGK(gl)GAAMVTAVAYR_
HRAS Ubiquitylation K170 -1.005 _K(gl)LNPPDESGPGCMSCK_
IKBKB Ubiquitylation K106 0.253 _K(gl)YLNQFENCCGLR_
IKBKB Phosphorylation S672 0.670 0.244 _GPVSGS(ph)PDSMNASR_
INPP5K Ubiquitylation K248 -0.741 0.167 _LLFPPTYK(gl)FDR_
INSR Ubiquitylation K1022 -0.603 _EK(gl)ITLLR_
INSR Ubiquitylation K1047 0.305 0.711 _DIIK(gl)GEAETR_
INSR Ubiquitylation K1057 0.482 0.484 _VAVK(gl)TVNESASLR_
INSR Ubiquitylation K1352 1.606 2.754 _DGGSSLGFK(gl)R_
IRS1 Phosphorylation S1101 -0.078 _HSS(ph)ETFSSTPSATR_
IRS2 Phosphorylation S308 -0.079 -0.510 _SKS(ph)QSSGSSATHPISVPGAR_
IRS2 Phosphorylation T365 0.641 0.852 _T(ph)ASEGDGGAAAGAAAAGAR_
IRS2 Phosphorylation S367 0.757 0.612 _TAS(ph)EGDGGAAAGAAAAGAR_
IRS2 Phosphorylation S393 -1.580 -1.221 _PVSVAGSPLS(ph)PGPVR_
IRS2 Phosphorylation S520 0.359 -1.006 _S(ph)NTPESIAETPPAR_
IRS2 Phosphorylation T522 -1.103 -0.770 _SNT(ph)PESIAETPPAR_
IRS2 Phosphorylation T529 0.230 0.164 _S(ph)NTPESIAET(ph)PPAR_
IRS2 Phosphorylation S562 -0.026 0.439 _RVS(ph)GDAAQDLDR_
IRS2 Phosphorylation S579 0.542 0.362 _RTYS(ph)LTTPAR_
IRS2 Phosphorylation S621 -0.190 _LCPSCPAS(ph)SPK_
IRS2 Phosphorylation S622 -0.195 _LCPSCPASS(ph)PK_
IRS2 Phosphorylation S681 0.409 _SDDYM(ox)PM(ox)S(ph)PASVSAPK_
IRS2 Phosphorylation S732 -1.089 _AS(ph)SPAESSPEDSGYM(ox)R_
IRS2 Phosphorylation S733 -1.027 0.522 _ASS(ph)PAESSPEDSGYM(ox)R_
IRS2 Phosphorylation S738 0.522 _ASS(ph)PAESS(ph)PEDSGYMR_
IRS2 Phosphorylation S917 -0.592 -1.025 _S(ph)PGEYINIDFGEPGAR_
IRS2 Phosphorylation S1164 -0.499 _HSSETFSSTTTVTPVS(ph)PSFAHNPK_
IRS2 Phosphorylation S1178 0.766 0.277 _HNSAS(ph)VENVSLR_
IRS2 Phosphorylation T1204 -0.454 _SSEGGVGVGPGGGDEPPT(ph)SPR_
IRS2 Phosphorylation S1205 -0.291 _SSEGGVGVGPGGGDEPPTS(ph)PR_
IRS4 Phosphorylation S64 -0.090 -0.062 _S(ph)DSESEEEDLPVGEEVCK_
IRS4 Phosphorylation S66 -0.354 -0.098 _SDS(ph)ESEEEDLPVGEEVCK_
IRS4 Ubiquitylation K99 -1.384 _YFVLK(gl)LETADAPAR_
IRS4 Ubiquitylation K202 -0.581 -0.941 _LILESK(gl)R_
IRS4 Ubiquitylation K240 -0.370 -0.760 _DVWQVIVK(gl)PR_
IRS4 Ubiquitylation K248 -0.351 -0.699 _K(gl)ELSGVFR_
IRS4 Phosphorylation S409 -0.928 -0.559 _FVTPSEPVAHS(ph)R_
IRS4 Phosphorylation S427 -0.406 0.053 _AVS(ph)VPASFFR_
IRS4 Phosphorylation S439 -1.003 -1.061 _RLAPS(ph)PARPR_
IRS4 Phosphorylation S457 0.337 _LS(ph)SEVSGSGSGNFGEEGNPQGK_
IRS4 Phosphorylation S458 0.236 _LSS(ph)EVSGSGSGNFGEEGNPQGK_
IRS4 Ubiquitylation K618 0.019 0.005 _SYFGK(gl)LTQSK_
IRS4 Ubiquitylation K674 -0.511 -0.585 _EVK(gl)DAEIPEGAAR_
IRS4 Phosphorylation Y743 -0.204 0.833 _GY(ph)MMMFPR_
IRS4 Phosphorylation S751 -1.810 -1.680 _VS(ph)PPPAPS(ph)PPK_
IRS4 Phosphorylation S757 -2.068 _VS(ph)PPPAPS(ph)PPK_
IRS4 Phosphorylation T764 -0.886 _APDT(ph)NKEDDSKDNDSESDYMFMAPGAGAIPK_
IRS4 Phosphorylation S775 -0.869 _APDTNKEDDSKDNDS(ph)ESDYMFMAPGAGAIPK_
IRS4 Phosphorylation S777 -0.884 -1.011 _APDTNKEDDSKDNDSES(ph)DYMFMAPGAGAIPK_
IRS4 Phosphorylation Y779 -0.702 -0.231 _APDTNKEDDSKDNDSESDY(ph)MFMAPGAGAIPK_
IRS4 Phosphorylation S804 -0.814 -0.440 _S(ph)WSSYFSLPNPFR_
IRS4 Phosphorylation S810 -1.350 _SWSSYFS(ph)LPNPFR_
IRS4 Phosphorylation S817 -1.106 -1.146 _S(ph)SPLGQNDNSEYVPM(ox)LPGK_
IRS4 Phosphorylation S818 -1.196 -1.146 _S(ph)SPLGQNDNSEYVPM(ox)LPGK_
IRS4 Phosphorylation S826 -0.663 -0.805 _SSPLGQNDNS(ph)EYVPM(ox)LPGK_
IRS4 Ubiquitylation K835 -1.658 -1.572 _SSPLGQNDNSEYVPM(ox)LPGK(gl)FLGR_
IRS4 Phosphorylation S872 -2.103 _PGDGGS(ph)PSKPSDHEPPK_
IRS4 Ubiquitylation K897 -0.308 -0.294 _LSFITK(gl)GYK_
IRS4 Phosphorylation Y921 0.195 -0.259 _EADSSSDY(ph)VNM(ox)DFTK_
IRS4 Ubiquitylation K928 -0.946 -1.115 _EADSSSDYVNMDFTK(gl)R_
IRS4 Phosphorylation S931 -0.413 -1.058 _RES(ph)NTPAPSTQGLPDSWGIIAEPR_
IRS4 Phosphorylation T933 -1.405 _RESNT(ph)PAPSTQGLPDSWGIIAEPR_
IRS4 Phosphorylation S1061 0.641 0.325 _IYVVDPFSECCM(ox)DISLS(ph)PSR_
IRS4 Phosphorylation S1091 -0.218 -0.449 _SQS(ph)FFAAAR_
IRS4 Phosphorylation S1107 -0.374 -0.244 _AAVSAFPTDS(ph)LER_
IRS4 Phosphorylation S1231 -1.675 _VPRPPEREDS(ph)DNDDDTHVR_
IRS4 Phosphorylation S1252 -0.763 _RDNQFDS(ph)PKR_
IRS4 Ubiquitylation K1254 -2.066 -1.156 _RDNQFDSPK(gl)R_
KRAS Ubiquitylation K128 1.528 1.433 _TVDTK(gl)QAHELAK_
KRAS Ubiquitylation K235 0.591 0.087 _TVDTK(gl)QAQDLAR_
KRAS Ubiquitylation K254 -0.450 -0.156 _SYGIPFIETSAK(gl)TR_
MAP2K1 Ubiquitylation K192 -0.205 -0.241 _DVK(gl)PSNILVNSR_
MAP2K1 Phosphorylation S385 0.066 _RSDAEEVDFAGWLCSTIGLNQPS(ph)TPTHAAGV_
MAP2K1 Phosphorylation T386 0.377 _RSDAEEVDFAGWLCSTIGLNQPST(ph)PTHAAGV_
MAP2K2 Phosphorylation S23 0.873 0.258 _RKPVLPALTINPTIAEGPS(ph)PTSEGASEANLVDLQK_
MAP2K2 Phosphorylation T25 0.439 _RKPVLPALTINPTIAEGPSPT(ph)SEGASEANLVDLQK_
MAP2K2 Ubiquitylation K192 -0.205 -0.241 _DVK(gl)PSNILVNSR_
MAP2K2 Phosphorylation S293 -0.361 _ELEAIFGRPVVDGEEGEPHS(ph)ISPR_
MAP2K2 Phosphorylation S295 -0.234 0.026 _ELEAIFGRPVVDGEEGEPHSIS(ph)PR_
MAP2K2 Phosphorylation T394 0.570 0.158 _LNQPGT(ph)PTR_
MAPK3 Phosphorylation Y204 -0.807 -2.487 _IADPEHDHTGFLTEY(ph)VATR_
MAPK3 Ubiquitylation K289 -0.608 _NYLQSLPSKTK(gl)_
MAPK9 Phosphorylation Y185 3.533 _TACTNFMMTPY(ph)VVTR_
MTOR Ubiquitylation K309 -0.762 0.065 _DLMGFGTK(gl)PR_
MTOR Ubiquitylation K1257 -1.167 -0.901 _SGQGDALASGPVETGPMKK(gl)_
MTOR Ubiquitylation K1395 -1.255 _AYAK(gl)ALHYK_
MTOR Ubiquitylation K2066 -1.004 _GPQTLK(gl)ETSFNQAYGR_
MTOR Ubiquitylation K2166 -1.304 _IQSIAPSLQVITSK(gl)QRPR_
MTOR Phosphorylation T2471 0.329 _KT(ph)GTTVPESIHSFIGDGLVKPEALNK_
NRAS Ubiquitylation K128 1.528 1.433 _TVDTK(gl)QAHELAK_
PCK1 Phosphorylation S13 1.866 0.458 _(ac)TTGRTM(ox)YVIPFS(ph)M(ox)GPLGS(ph)PLS(ph)K_
PCK1 Phosphorylation S19 1.866 -1.827 _(ac)TTGRTM(ox)YVIPFS(ph)M(ox)GPLGS(ph)PLS(ph)K_
PCK1 Phosphorylation S22 1.866 0.458 _(ac)TTGRTM(ox)YVIPFS(ph)M(ox)GPLGS(ph)PLS(ph)K_
PDPK1 Phosphorylation S241 0.358 0.361 _ANS(ph)FVGTAQYVSPELLTEK_
PDPK1 Ubiquitylation K257 0.571 -0.234 _ANSFVGTAQYVSPELLTEK(gl)SACK_
PHKA2 Ubiquitylation K286 -0.415 _NEIISK(gl)LQGR_
PHKA2 Ubiquitylation K705 0.064 _DILSVMAK(gl)AK_
PHKA2 Ubiquitylation K707 0.064 _DILSVMAK(gl)AK_
PHKA2 Phosphorylation S729 0.325 _S(ph)LNLVDSPQPLLEK_
PHKA2 Phosphorylation S1015 1.066 0.529 _RFS(ph)ADEQFFSVGQAASSSAHSSK_
PHKB Phosphorylation S4 0.779 0.984 _(ac)ACS(ph)PDAVVSPSSAFLR_
PHKB Phosphorylation T702 -0.041 _QSST(ph)PSAPELGQQPDVNISEWK_
PHKG2 Ubiquitylation K265 0.212 _SSTVK(gl)DLISR_
PIK3CA Ubiquitylation K864 0.390 0.588 _NSHTIM(ox)QIQCK(gl)GGLK_
PIK3CA Ubiquitylation K868 0.204 0.651 _NSHTIM(ox)QIQCKGGLK(gl)_
PIK3CA Ubiquitylation K974 -0.273 _GAQECTK(gl)TREFER_
PIK3CB Ubiquitylation K1044 0.990 _SEEEALKQFKQK(gl)_
PIK3R2 Phosphorylation S262 -2.237 _APPPPS(ph)SPPPGGAPDGSEPSPDFPALLVEK_
PIK3R2 Phosphorylation S263 -2.237 _APPPPS(ph)SPPPGGAPDGSEPSPDFPALLVEK_
PIK3R2 Ubiquitylation K500 -0.189 _IFEEQGQTQEK(gl)CSK_
PIK3R2 Ubiquitylation K541 -0.609 _TK(gl)LEQQLR_
PIK3R2 Ubiquitylation K564 -0.431 -1.022 _MNSLK(gl)PDLMQLR_
PIK3R3 Ubiquitylation K226 -0.376 _YQQDQLVKEDNIDAVGKK(gl)_
PIK3R3 Ubiquitylation K320 0.385 _LGEIHDSK(gl)MR_
PPP1CA Ubiquitylation K6 0.594 0.414 _(ac)SDSEK(gl)LNLDSIIGR_
PPP1CA Ubiquitylation K50 -0.131 0.478 _GLCLK(gl)SR_
PPP1CA Ubiquitylation K150 0.321 0.619 _IYGFYDECK(gl)RR_
PPP1CA Ubiquitylation K156 0.883 1.047 _YNIK(gl)LWK_
PPP1CA Ubiquitylation K247 0.313 _FLHK(gl)HDLDLICR_
PPP1CA Ubiquitylation K269 2.628 2.591 _AHQVVEDGYEFFAK(gl)R_
PPP1CB Ubiquitylation K146 0.352 _FNIK(gl)LWK_
PPP1CB Ubiquitylation K150 0.321 0.619 _IYGFYDECK(gl)RR_
PPP1CB Ubiquitylation K269 2.628 2.591 _AHQVVEDGYEFFAK(gl)R_
PPP1CC Ubiquitylation K35 -0.280 -0.504 _GSKPGK(gl)NVQLQENEIR_
PPP1CC Ubiquitylation K50 -0.131 0.478 _GLCLK(gl)SR_
PPP1CC Ubiquitylation K150 0.321 0.619 _IYGFYDECK(gl)RR_
PPP1CC Ubiquitylation K156 0.883 1.047 _YNIK(gl)LWK_
PPP1CC Ubiquitylation K247 0.313 _FLHK(gl)HDLDLICR_
PPP1CC Ubiquitylation K269 2.628 2.591 _AHQVVEDGYEFFAK(gl)R_
PPP1CC Phosphorylation T320 -0.561 _KPNATRPVT(ph)PPR_
PPP1CC Ubiquitylation K328 0.848 0.425 _GMITK(gl)QAK_
PRKAA1 Ubiquitylation K271 -0.536 _ATIK(gl)DIR_
PRKAA1 Ubiquitylation K396 -0.419 _HTLDELNPQK(gl)SK_
PRKAA1 Ubiquitylation K485 -1.326 -1.554 _SIDDEITEAK(gl)SGTATPQR_
PRKAA2 Ubiquitylation K271 -0.536 _ATIK(gl)DIR_
PRKAA2 Phosphorylation S377 -0.020 _MPPLIADS(ph)PK_
PRKAB1 Phosphorylation S108 -0.357 0.129 _S(ph)HNNFVAILDLPEGEHQYK_
PRKACA Ubiquitylation K30 -0.143 _AKEDFLKK(gl)_
PRKACA Ubiquitylation K93 0.839 0.714 _QIEHTLNEK(gl)R_
PRKACB Ubiquitylation K30 -0.143 _AKEDFLKK(gl)_
PRKACB Ubiquitylation K93 0.839 0.714 _QIEHTLNEK(gl)R_
PRKACB Phosphorylation T243 -0.835 _T(ph)WTLCGTPEYLAPEIILSK_
PRKACB Phosphorylation T245 -0.116 -0.102 _TWT(ph)LCGTPEYLAPEIILSK_
PRKAG1 Ubiquitylation K78 -0.588 _AAPLWDSK(gl)K_
PRKAG1 Ubiquitylation K79 -0.588 _AAPLWDSK(gl)K_
PRKAG1 Ubiquitylation K243 -0.525 -0.505 _VSALPVVDEK(gl)GR_
PRKAG2 Ubiquitylation K78 -0.588 _AAPLWDSK(gl)K_
PRKAG2 Ubiquitylation K79 -0.588 _AAPLWDSK(gl)K_
PRKAG2 Ubiquitylation K243 -0.525 -0.505 _VSALPVVDEK(gl)GR_
PRKAR1A Ubiquitylation K63 -1.895 _LEKEEAK(gl)QIQNLQK_
PRKAR1A Ubiquitylation K70 -0.869 0.073 _QIQNLQK(gl)AGTR_
PRKAR1A Phosphorylation S83 -0.969 -0.776 _EDEIS(ph)PPPPNPVVK_
PRKAR1A Ubiquitylation K92 -3.269 -2.395 _TDSREDEISPPPPNPVVK(gl)GR_
PRKAR1A Ubiquitylation K222 0.412 0.536 _TNVK(gl)LWGIDR_
PRKAR1A Ubiquitylation K244 -0.384 3.721 _K(gl)MYEEFLSK_
PRKAR1A Ubiquitylation K261 -0.886 _VSILESLDK(gl)WER_
PRKAR1A Ubiquitylation K346 0.329 _GPLK(gl)CVK_
PRKAR1A Ubiquitylation K349 -0.425 -0.103 _CVK(gl)LDRPR_
PRKAR1A Ubiquitylation K367 -0.939 0.044 _VLGPCSDILK(gl)R_
PRKAR1B Phosphorylation S3 0.185 0.343 _(ac)AS(ph)PPACPSEEDESLKGCELYVQLHGIQQVLK_
PRKAR1B Ubiquitylation K244 -0.384 3.721 _K(gl)MYEEFLSK_
PRKAR1B Ubiquitylation K346 0.329 _GPLK(gl)CVK_
PRKAR1B Ubiquitylation K349 -0.425 -0.103 _CVK(gl)LDRPR_
PRKAR2A Phosphorylation S99 0.020 0.056 _RVS(ph)VCAETYNPDEEEEDTDPR_
PRKAR2A Phosphorylation T104 -0.175 _RVSVCAET(ph)YNPDEEEEDTDPR_
PRKAR2A Ubiquitylation K359 0.640 _GQYFGELALVTNK(gl)PR_
PRKAR2B Phosphorylation T69 -0.367 _TWGDLGAAAGGGT(ph)PSK_
PRKAR2B Phosphorylation S114 0.366 0.525 _RAS(ph)VCAEAYNPDEEEDDAESR_
PRKAR2B Ubiquitylation K359 0.640 _GQYFGELALVTNK(gl)PR_
PRKCI Ubiquitylation K244 0.289 _ESGK(gl)ASSSLGLQDFDLLR_
PRKCI Ubiquitylation K488 -0.090 0.847 _SLSVK(gl)AASVLK_
PRKCZ Phosphorylation T560 -0.884 -1.578 _KQALPPFQPQITDDYGLDNFDTQFTSEPVQLT(ph)PDDEDAIKR_
PTPN1 Phosphorylation S352 0.032 _GS(ph)PLNAAPYGIESMSQDTEVR_
PTPN1 Phosphorylation S365 -0.247 0.956 _GSPLNAAPYGIESMS(ph)QDTEVR_
PTPN1 Phosphorylation S378 1.462 1.262 _VVGGS(ph)LR_
PTPRF Ubiquitylation K1650 -0.595 -1.027 _LLASSK(gl)AHTSR_
PTPRF Ubiquitylation K1665 -0.790 _FISANLPCNK(gl)FK_
PYGB Ubiquitylation K32 -0.285 _(ac)AKPLTDSEK(gl)R_
PYGB Ubiquitylation K290 -1.900 _VLYPNDNFFEGK(gl)ELR_
PYGB Ubiquitylation K460 0.084 _MSVIEEGDCK(gl)R_
PYGL Ubiquitylation K3 -1.000 _(ac)AK(gl)PLTDQEK_
PYGL Ubiquitylation K10 -1.798 -0.985 _(ac)AKPLTDQEK(gl)R_
PYGL Ubiquitylation K30 0.225 _GIVGVENVAELKK(gl)_
PYGL Ubiquitylation K32 -0.285 _(ac)AKPLTDSEK(gl)R_
PYGL Ubiquitylation K170 -0.689 -0.151 _YEYGIFNQK(gl)IR_
PYGL Ubiquitylation K290 -1.900 _VLYPNDNFFEGK(gl)ELR_
PYGL Ubiquitylation K421 -1.738 _IVALFPK(gl)DVDR_
PYGL Ubiquitylation K438 -0.631 _MSLIEEEGSK(gl)R_
PYGL Ubiquitylation K460 0.084 _MSVIEEGDCK(gl)R_
PYGL Ubiquitylation K467 -0.475 _IHSDIVKTK(gl)_
PYGL Ubiquitylation K569 -0.715 _INPSSMFDVQVK(gl)R_
PYGL Ubiquitylation K724 -0.011 0.111 _IDDVAALDK(gl)K_
PYGL Ubiquitylation K725 -0.011 _IDDVAALDK(gl)K_
PYGL Ubiquitylation K804 1.172 0.214 _AWNTMVLK(gl)NIAASGK_
PYGL Ubiquitylation K811 -0.458 _NIAASGK(gl)FSSDR_
PYGM Ubiquitylation K32 -0.285 _(ac)AKPLTDSEK(gl)R_
PYGM Ubiquitylation K460 0.084 _MSVIEEGDCK(gl)R_
RAF1 Phosphorylation S29 0.028 -0.571 _DAVFDGSSCIS(ph)PTIVQQFGYQR_
RAF1 Phosphorylation T31 0.028 -0.669 _DAVFDGSSCIS(ph)PTIVQQFGYQR_
RAF1 Phosphorylation S244 0.053 _YSTPHAFTFNTSS(ph)PSSEGSLSQR_
RAF1 Phosphorylation S259 -0.069 0.054 _STS(ph)TPNVHM(ox)VSTTLPVDSR_
RAF1 Phosphorylation S301 -0.651 _SHSESASPSALSSSPNNLS(ph)PTGWSQPK_
RAF1 Phosphorylation T303 -0.664 _SHSESASPSALSSSPNNLSPT(ph)GWSQPK_
RAF1 Phosphorylation S497 -0.449 _SRWS(ph)GSQQVEQPTGSVLWMAPEVIR_
RAF1 Phosphorylation S621 0.212 0.271 _SAS(ph)EPSLHR_
RAF1 Phosphorylation S642 -0.197 0.463 _AAHTEDINACTLTTS(ph)PR_
RAPGEF1 Phosphorylation S377 0.629 _LSKS(ph)DEQLSSLDR_
RHEB Ubiquitylation K121 -0.852 _VQIPIMLVGNKK(gl)_
RHOQ Ubiquitylation K115 -1.745 -0.215 _AK(gl)WYPEVR_
RHOQ Ubiquitylation K139 0.125 _LNDMK(gl)EKPICVEQGQK_
RHOQ Ubiquitylation K141 0.125 _LNDMK(gl)EKPICVEQGQK_
RHOQ Ubiquitylation K142 0.492 _LDLRDDK(gl)DTIEK_
RHOQ Ubiquitylation K152 0.099 -0.292 _K(gl)LTPITYPQGLAMAK_
RHOQ Ubiquitylation K166 -0.981 -0.655 _LTPITYPQGLAMAK(gl)EIGAVK_
RHOQ Ubiquitylation K172 1.026 0.412 _EIGAVK(gl)YLECSALTQR_
RHOQ Ubiquitylation K185 -0.113 0.578 _GLK(gl)TVFDEAIR_
RHOQ Ubiquitylation K202 -1.379 -1.447 _AVLCPPPVK(gl)KR_
RHOQ Ubiquitylation K203 -1.708 -1.447 _AVLCPPPVKK(gl)_
RPS6 Ubiquitylation K58 2.088 1.670 _ISGGNDK(gl)QGFPMK_
RPS6 Phosphorylation S235 2.968 _LS(ph)SLRAS(ph)TSK_
RPS6 Phosphorylation S236 2.333 3.174 _LSS(ph)LRAS(ph)TSK_
RPS6 Phosphorylation S240 2.384 2.672 _LSSLRAS(ph)TSK_
RPS6 Phosphorylation T241 3.252 3.164 _LSS(ph)LRAST(ph)SK_
RPS6KB1 Ubiquitylation K99 -0.316 _VLGK(gl)GGYGK_
RPS6KB1 Phosphorylation S447 -0.525 -0.458 _TPVS(ph)PVKFSPGDFWGR_
RPS6KB2 Ubiquitylation K99 -0.316 _VLGK(gl)GGYGK_
RPTOR Phosphorylation S722 0.393 1.196 _SVSS(ph)YGNIR_
RPTOR Phosphorylation T857 -0.348 _VLDTSSLT(ph)QSAPAS(ph)PTNK_
RPTOR Phosphorylation S859 -0.462 -0.346 _VLDTSSLTQS(ph)APASPT(ph)NK_
RPTOR Phosphorylation S863 -0.208 -0.001 _VLDTSSLTQS(ph)APAS(ph)PTNK_
RPTOR Phosphorylation T865 -0.317 _VLDTSSLTQS(ph)APASPT(ph)NK_
RPTOR Phosphorylation S877 -0.114 -0.074 _GVHIHQAGGS(ph)PPASSTSSSSLTNDVAK_
RPTOR Ubiquitylation K1008 -0.329 _QAQQVIQK(gl)GITR_
SORBS1 Phosphorylation S57 -0.823 0.018 _ETPSSSPAS(ph)PQETR_
SORBS1 Phosphorylation S548 -0.502 -0.518 _RVGEQDSAPTQEKPTS(ph)PGK_
SOS1 Phosphorylation S1082 0.278 _IPESETESTASAPNS(ph)PR_
SOS1 Phosphorylation S1166 0.097 -0.094 _RPESAPAES(ph)SPSK_
SREBF1 Ubiquitylation K321 -0.637 _LAAGSK(gl)APASAQSR_
SREBF1 Ubiquitylation K579 -1.649 0.673 _K(gl)QADLDLAR_
TRIP10 Phosphorylation S296 0.064 0.030 _APS(ph)DSSLGTPSDGRPELR_
TSC1 Phosphorylation S505 0.141 0.350 _GGFDS(ph)PFYR_
TSC2 Ubiquitylation K3 -1.397 _(ac)AK(gl)PTSKDSGLK_
TSC2 Ubiquitylation K14 -1.297 _DSGLKEK(gl)FK_
TSC2 Ubiquitylation K69 0.051 _MIGQICEVAK(gl)TK_
TSC2 Ubiquitylation K71 -0.157 _MIGQICEVAKTK(gl)_
TSC2 Ubiquitylation K258 -0.278 _ELCEPCWK(gl)LMR_
TSC2 Ubiquitylation K634 1.610 _LGLPNK(gl)DGVVR_
TSC2 Phosphorylation S950 -0.152 -0.529 _STS(ph)LNERPK_
TSC2 Phosphorylation S1064 -0.927 _SLLGLDSGELQSGPESSSS(ph)PGVHVR_
TSC2 Phosphorylation S1248 -0.604 _SNTDSAVVMEEGS(ph)PGEVPVLVEPPGLEDVEAALGMDRR_
TSC2 Phosphorylation S1329 -0.120 _S(ph)SSSPELQTLQDILGDPGDK_
TSC2 Phosphorylation S1331 -0.262 _SSS(ph)SPELQTLQDILGDPGDKADVGR_
TSC2 Phosphorylation S1332 -0.063 _SSSS(ph)PELQTLQDILGDPGDK_
TSC2 Phosphorylation S1355 0.174 0.351 _ADVGRLS(ph)PEVK_
TSC2 Phosphorylation S1362 0.859 _S(ph)QSGTLDGESAAWSASGEDSR_
TSC2 Phosphorylation S1364 0.522 0.550 _SQS(ph)GTLDGESAAWSASGEDSR_
TSC2 Phosphorylation T1366 0.137 _SQSGT(ph)LDGESAAWSASGEDSR_
TSC2 Phosphorylation S1396 0.498 _S(ph)PSGLRPR_
TSC2 Phosphorylation S1743 0.596 _RLISS(ph)VEDFTEFV_


.

© Copyright Svejstrup Laboratory 2015