bioLOGIC Data » bioLOGIC CategoryView » bioLOGIC VennView » Experimental Details »
bioLOGIC Category

Results for the Category
forebrain development
(GO:0030900)

RNAi screen result RNAPII IP (MG132) CSB IP CSB IP (MG132) Chrom. Chrom. (MG132) Ubi /Phospo Ubi /Phospho (MG132)
W

Protein Results:

Results for post-translational modifications (below)
Gene name MGoogle Score RNAi high RNAi low RNAPII-IP (MG132) CSB-IP CSB-IP (MG132) Chrom. Chrom. (MG132)
SETD2 3 -1.690 2.960 1.619 1.725 -0.978 0.379
ATRX 2 0.050 0.010 0.582 0.629
FYN 1 1.080 -1.100
FYN 1 1.080 -1.100
NDE1 1
TOP2B 1 0.830 -0.650 -1.137 0.859 0.666
GNAO1 1 1.200 -1.320 0.217 -0.334 -0.374
KDM2B 1 -0.080 -0.260
KDM2B 1 -0.080 -0.260 0.216 0.247
ARID1A 1 0.360 -0.350 0.683 0.272 0.870 -0.131 0.043
PSEN2 1 -1.820 3.280
POU3F1 1 -1.360 2.530
NCOR2 1 1.850 -1.050
NCOR2 1 1.850 -1.050 0.037 -1.127
FGFR3 0 -1.120 1.390
LRP6 0 0.210 0.050
PSEN1 0 0.930 -1.110
APLP2 0 -0.080 0.400
MECOM 0 0.130 -0.120 -0.189 0.565 -1.171
MECOM 0 0.740 -0.750 -0.189 0.565 -1.171
GLI3 0 -0.980 1.650
HTRA2 0 1.220 -0.530 0.602 -0.023 1.287
SMARCA4 0 -0.810 1.520 0.629 -0.158 0.141 0.337 0.333
TWSG1 0 0.420 -0.740
ALDH1A2 0 -1.010 0.740
DCLK1 0 -1.340 1.710
DCLK1 0 -1.340 1.710
NUMB 0 0.310 0.050
NKX2-1 0 -0.730 0.480 0.174 0.236
NKX2-1 0 -0.730 0.480 -0.123
APP 0 0.100 -0.260 0.285
NFIB 0 -1.030 1.080 -0.711 0.025 0.306 1.031
ZEB1 0 0.640 -0.450
ZEB1 0 0.640 -0.450
ARHGAP35 0 1.030 -0.620 -0.833 0.397 0.020
MSX1 0 0.420 -0.450
DLC1 0 -0.650 0.390
CDK5 0 -1.100 1.740 -0.236 1.063 0.312
CTNNB1 0 0.490 -0.230
CTNNB1 0 0.490 -0.230 -0.415 0.628 0.215
NR2F1 0 -0.300 -0.080 0.225 0.992 0.424 0.474
FOXL1 0 0.560 -0.350 -1.217 -0.424 0.659
SOX2 0 -0.250 0.870
NR2F2 0 -1.120 1.260 -1.119 0.136 0.670
NR2F2 0 -1.120 1.260 0.225 0.992 0.424 0.474
DYNC2H1 0 -1.530 1.820 -0.319 0.050
DYNC2H1 0 -1.530 1.820 0.313
SRC 0 0.050 0.470 -0.031

PTM Sites:

Back to Protein Results
Gene name PTM type PTM site UV UV (MG132) Sequence
ALDH1A2 Ubiquitylation K365 -1.744 _VVGSPFDPTTEQGPQIDK(gl)K_
ALDH1A2 Ubiquitylation K366 -1.744 _VVGSPFDPTTEQGPQIDK(gl)K_
ALDH1A2 Ubiquitylation K507 0.123 _EYSEVK(gl)TVTVK_
APLP2 Ubiquitylation K744 -1.204 _HLNK(gl)M(ox)QNHGYENPTYK_
APP Ubiquitylation K751 -1.778 -1.280 _HLSK(gl)M(ox)QQNGYENPTYK_
ARHGAP35 Phosphorylation S975 -0.388 -0.423 _AGS(ph)PLCNSNLQDSEEDIEPSYSLFR_
ARHGAP35 Phosphorylation S1072 -0.719 _SVS(ph)SSPWLPQDGFDPSDYAEPMDAVVKPR_
ARHGAP35 Phosphorylation S1150 1.218 0.094 _KVS(ph)IVSKPVLYR_
ARHGAP35 Phosphorylation S1179 0.400 0.591 _TSFSVGS(ph)DDELGPIR_
ARID1A Phosphorylation S363 0.211 0.022 _SHHAPM(ox)S(ph)PGSSGGGGQPLAR_
ARID1A Phosphorylation S367 -0.142 _SHHAPMSPGSS(ph)GGGGQPLAR_
ARID1A Phosphorylation S381 0.335 _TPQPS(ph)SPMDQMGK_
ARID1A Phosphorylation S382 1.506 0.780 _TPQPSS(ph)PMDQMGK_
ARID1A Phosphorylation S696 -0.934 -0.737 _GPS(ph)PSPVGSPASVAQSR_
ARID1A Phosphorylation S702 0.267 -0.175 _GPS(ph)PSPVGS(ph)PASVAQSR_
ARID1A Phosphorylation S705 0.157 _GPS(ph)PSPVGSPAS(ph)VAQSR_
ARID1A Phosphorylation S772 -0.112 -0.485 _NPQMPQYSSPQPGSALS(ph)PR_
ARID1A Phosphorylation S1182 1.584 1.063 _S(ph)NSVGIQDAFNDGSDSTFQK_
ARID1A Phosphorylation S1184 1.732 1.114 _SNS(ph)VGIQDAFNDGSDSTFQK_
ARID1A Phosphorylation S1754 0.131 -0.654 _VS(ph)SPAPM(ox)EGGEEEEELLGPK_
ARID1A Phosphorylation S1755 -0.409 -0.587 _VSS(ph)PAPMEGGEEEEELLGPK_
ARID1A Phosphorylation S1944 -0.489 _FPFGIS(ph)PAQSHR_
ATRX Phosphorylation S34 -0.115 -0.055 _LHDFLAHSSEESEETSS(ph)PPR_
ATRX Phosphorylation S92 -0.219 -0.386 _YVES(ph)DDEKPLDDETVNEDASNENSENDITMQSLPK_
ATRX Phosphorylation S313 0.766 0.451 _VYEHTS(ph)RFSPK_
ATRX Phosphorylation S316 0.668 _VYEHTSRFS(ph)PK_
ATRX Ubiquitylation K403 0.759 _SVLADIK(gl)K_
ATRX Ubiquitylation K404 0.759 _SVLADIK(gl)K_
ATRX Phosphorylation S596 0.021 _LTPVSLS(ph)NSPIKGADCQEVPQDKDGYK_
ATRX Phosphorylation S598 -0.157 -0.195 _LTPVSLSNS(ph)PIK_
ATRX Phosphorylation S677 0.048 0.009 _RPTETNPVTSNS(ph)DEECNETVKEK_
ATRX Phosphorylation S819 0.797 0.578 _RQTQSESSNYDS(ph)ELEKEIK_
ATRX Phosphorylation S871 3.829 4.009 _NLKTS(ph)QEGSSDDAER_
ATRX Phosphorylation T887 1.203 1.421 _ET(ph)FSSAEGTVDKDTTIMELR_
ATRX Phosphorylation S889 0.942 _ETFS(ph)SAEGTVDKDTTIMELR_
ATRX Phosphorylation S1061 1.043 0.887 _KDELS(ph)DYAEK_
ATRX Phosphorylation S1527 -0.080 0.235 _EVIEIEDAS(ph)PTKCPITTK_
ATRX Ubiquitylation K2182 -0.315 _QVTK(gl)QSLSFR_
CDK5 Ubiquitylation K56 0.606 0.237 _EICLLK(gl)ELK_
CTNNB1 Ubiquitylation K158 -1.265 _AIPELTK(gl)LLNDEDQVVVNK_
CTNNB1 Ubiquitylation K180 -0.546 -0.636 _AAVM(ox)VHQLSK(gl)K_
CTNNB1 Ubiquitylation K181 -0.717 -0.729 _AAVMVHQLSKK(gl)_
CTNNB1 Phosphorylation S191 -0.024 0.129 _S(ph)PQMVSAIVR_
CTNNB1 Ubiquitylation K435 -0.350 _NK(gl)MM(ox)VCQVGGIEALVR_
CTNNB1 Ubiquitylation K496 -1.262 _LHYGLPVVVK(gl)_
CTNNB1 Phosphorylation S552 1.233 1.224 _RTS(ph)MGGTQQQFVEGVR_
CTNNB1 Phosphorylation T556 1.275 0.995 _RTSM(ox)GGT(ph)QQQFVEGVR_
CTNNB1 Ubiquitylation K671 -0.941 -0.934 _MSEDKPQDYK(gl)K_
DCLK1 Phosphorylation S32 0.456 0.202 _VNGLPS(ph)PTHSAHCSFYR_
DCLK1 Phosphorylation T336 -1.793 _SPSPSPT(ph)SPGSLR_
DCLK1 Phosphorylation S337 -0.893 -0.694 _SPSPSPTS(ph)PGSLR_
DCLK1 Phosphorylation S352 0.641 0.487 _SSQHGGS(ph)STSLASTK_
DCLK1 Phosphorylation S352 0.103 0.523 _DLYRPLS(ph)SDDLDSVGDSV_
DCLK1 Phosphorylation S353 0.566 _DLYRPLSS(ph)DDLDSVGDSV_
DLC1 Phosphorylation S842 -0.139 _TGS(ph)FHGPGHISLR_
DLC1 Phosphorylation S946 -0.497 _FSDEGDSDSALDSVSPCPSS(ph)PK_
DYNC2H1 Ubiquitylation K158 0.457 _SDTNLTK(gl)LK_
DYNC2H1 Ubiquitylation K398 -0.876 _IIAPAEQK(gl)IAGK_
DYNC2H1 Ubiquitylation K1248 -0.579 _AADLK(gl)DLNSR_
DYNC2H1 Ubiquitylation K2608 -1.364 _LNSTDLK(gl)DVIKK_
DYNC2H1 Ubiquitylation K2613 -1.117 _LNSTDLKDVIKK(gl)_
FGFR3 Ubiquitylation K205 -0.115 _IGGIK(gl)LR_
FOXL1 Phosphorylation S6 0.325 0.055 _YS(ph)VSSPNSLGVVPYLGGEQSYYR_
FOXL1 Phosphorylation S235 -1.239 _TENGTCPS(ph)PPQPLS(ph)PAAALGSGSAAAVPK_
FOXL1 Phosphorylation S241 -1.239 _TENGTCPS(ph)PPQPLS(ph)PAAALGSGSAAAVPK_
FOXL1 Phosphorylation S259 -0.376 -0.198 _IES(ph)PDSSSSSLSSGSSPPGSLPSAR_
FOXL1 Phosphorylation S320 0.313 0.178 _GS(ph)PQSAAAELSSGLLASAAASSR_
FOXL1 Phosphorylation S323 0.347 _GSPQS(ph)AAAELSSGLLASAAASSR_
FOXL1 Ubiquitylation K554 -0.030 0.013 _TSGAFVYDCSK(gl)F_
FYN Ubiquitylation K13 0.286 _DKEATK(gl)LTEER_
FYN Phosphorylation S21 0.373 0.731 _DGS(ph)LNQSSGYR_
FYN Ubiquitylation K259 0.921 _LTDLSVK(gl)TK_
FYN Ubiquitylation K261 0.099 _LTDLSVKTK(gl)_
FYN Ubiquitylation K273 6.025 _SLCLEKK(gl)_
FYN Ubiquitylation K275 -0.521 _ESLQLIK(gl)R_
GLI3 Phosphorylation S664 -0.582 -0.252 _S(ph)PGRPTQGALGEQQDLSNTTSK_
GNAO1 Ubiquitylation K29 0.529 -0.094 _NLREDGEK(gl)AAK_
GNAO1 Ubiquitylation K92 1.569 _LK(gl)IDFGEAAR_
GNAO1 Ubiquitylation K349 -0.221 -0.339 _NNLK(gl)ECGLY_
HTRA2 Ubiquitylation K237 -1.868 -0.270 _IQTK(gl)EPLPTLPLGR_
KDM2B Ubiquitylation K129 -0.632 _DVK(gl)LLVGSR_
KDM2B Phosphorylation S357 -0.521 -0.434 _SSS(ph)PTAGPSTEGAEGPEEK_
KDM2B Phosphorylation S394 1.119 1.347 _ELS(ph)KELNHEIQR_
KDM2B Phosphorylation S443 2.646 _APKPPTDGS(ph)TSPTSTPSEDQEALGK_
KDM2B Phosphorylation S458 1.030 _HQLGPS(ph)LRSPPR_
KDM2B Phosphorylation S461 0.284 _HQLGPSLRS(ph)PPR_
KDM2B Phosphorylation S472 -0.918 -1.112 _VISRPPPS(ph)VSPPK_
KDM2B Phosphorylation S474 -0.740 -1.153 _VISRPPPSVS(ph)PPK_
LRP6 Ubiquitylation K1443 -0.221 _GK(gl)SMISSLSIMGGSSGPPYDR_
MECOM Phosphorylation S62 -1.041 -0.744 _EGS(ph)PYKAPIYIPDDIPIPAEFELR_
MECOM Phosphorylation S1039 -0.074 0.136 _NFIGNSNHGSQS(ph)PR_
MSX1 Phosphorylation S154 0.148 _RLS(ph)PPACTLR_
NCOR2 Phosphorylation S939 -0.637 _LLS(ph)PRPSLLTPTGDPR_
NCOR2 Phosphorylation S943 -0.740 _LLSPRPS(ph)LLTPTGDPR_
NCOR2 Phosphorylation S956 -0.223 -0.308 _ANAS(ph)PQKPLDLK_
NCOR2 Phosphorylation S1023 -0.334 _S(ph)RSPAPPADKEAFAAEAQK_
NCOR2 Phosphorylation S1025 1.950 _SRS(ph)PAPPADKEAFAAEAQK_
NCOR2 Phosphorylation T1383 -1.746 -2.157 _EGT(ph)PPPPPPSR_
NCOR2 Phosphorylation S1479 0.325 -0.132 _SLIGS(ph)PGR_
NCOR2 Phosphorylation S1778 -0.687 _HSSSPLS(ph)PGGPTHLTKPTTTSSSER_
NCOR2 Phosphorylation S1970 -0.321 _SGLEPAS(ph)SPSK_
NCOR2 Phosphorylation S1971 -0.480 _SGLEPASS(ph)PSK_
NCOR2 Phosphorylation S2223 -0.074 -1.140 _TSVLGGGEDGIEPVS(ph)PPEGMTEPGHSR_
NCOR2 Phosphorylation S2258 -0.573 -0.210 _S(ph)PGNTSQPPAFFSK_
NCOR2 Phosphorylation S2413 0.973 _AKS(ph)PAPGLASGDRPPSVSSVHSEGDCNR_
NDE1 Ubiquitylation K270 2.830 _VGALESK(gl)LASCR_
NDE1 Phosphorylation S282 -0.767 -0.382 _NLVYDQS(ph)PNR_
NDE1 Phosphorylation S306 -2.156 _RPS(ph)STSVPLGDK_
NFIB Phosphorylation S294 -1.873 _TISIDENM(ox)EPSPTGDFYPSPS(ph)SPAAGSR_
NFIB Phosphorylation S295 -1.280 _TISIDENMEPSPTGDFYPSPSS(ph)PAAGSR_
NFIB Phosphorylation S300 -1.728 _TISIDENM(ox)EPSPTGDFYPSPSSPAAGS(ph)R_
NFIB Phosphorylation S311 1.021 0.671 _DQDMS(ph)SPTTM(ox)K_
NFIB Phosphorylation S312 0.764 0.746 _DQDMSS(ph)PTTMK_
NFIB Phosphorylation T314 0.827 _DQDMSSPT(ph)TMK_
NFIB Phosphorylation S325 0.852 _KPEKPLFS(ph)SASPQDSSPR_
NFIB Phosphorylation S328 1.295 0.637 _KPEKPLFSSAS(ph)PQDSSPR_
NFIB Phosphorylation S332 -0.428 -1.102 _KPEKPLFSSASPQDS(ph)SPR_
NFIB Phosphorylation S333 -0.428 _KPEKPLFSSASPQDS(ph)SPR_
NR2F2 Ubiquitylation K362 0.144 _FGK(gl)LLLR_
NR2F2 Ubiquitylation K389 -0.473 -0.156 _LVGK(gl)TPIETLIR_
NUMB Ubiquitylation K63 0.281 _GMHICEDAVK(gl)R_
NUMB Phosphorylation T436 0.878 _RT(ph)PSEADRWLEEVSK_
POU3F1 Ubiquitylation K377 0.051 -0.035 _LK(gl)PLLNK_
PSEN1 Phosphorylation S313 0.844 _VSKNS(ph)KYNAESTER_
PSEN1 Ubiquitylation K314 0.016 0.414 _NSK(gl)YNAESTER_
PSEN1 Phosphorylation S366 -0.340 0.055 _AAVQELSS(ph)SILAGEDPEER_
PSEN1 Phosphorylation S367 0.005 0.066 _AAVQELSSS(ph)ILAGEDPEER_
PSEN2 Phosphorylation S58 -0.112 -0.130 _TSLM(ox)SAES(ph)PTPR_
SETD2 Phosphorylation S130 -0.443 _M(ox)EIGDTLSTAEES(ph)SPPK_
SETD2 Phosphorylation S131 -0.001 -0.163 _M(ox)EIGDTLSTAEESS(ph)PPK_
SETD2 Phosphorylation S624 0.374 0.432 _LNDS(ph)PTLKK_
SETD2 Phosphorylation S708 0.398 _TDAVLM(ox)TSDDSVTGSELS(ph)PLVK_
SETD2 Phosphorylation S742 -1.167 -1.779 _S(ph)ESPFRETEPLVSPHQDK_
SETD2 Phosphorylation S744 -0.557 _SES(ph)PFRETEPLVSPHQDK_
SETD2 Phosphorylation T1083 0.552 _NSTLPMEET(ph)SPCSSR_
SETD2 Phosphorylation S1084 -0.102 _NSTLPMEETS(ph)PCSSR_
SETD2 Phosphorylation T1872 -0.148 -1.034 _LSTEADTDT(ph)PKK_
SETD2 Phosphorylation S1885 0.110 _IIS(ph)ENSMDSAISDATSELEGK_
SETD2 Phosphorylation S1888 1.247 0.067 _IISENS(ph)M(ox)DSAISDATSELEGK_
SMARCA4 Ubiquitylation K357 -0.934 _ITPIQK(gl)PR_
SMARCA4 Ubiquitylation K405 0.109 1.148 _ATIELK(gl)ALR_
SMARCA4 Ubiquitylation K437 -0.317 _DTALETALNAK(gl)AYKR_
SMARCA4 Ubiquitylation K455 0.225 _ITEK(gl)LEK_
SMARCA4 Ubiquitylation K496 0.923 _SVTGK(gl)IQK_
SMARCA4 Phosphorylation S677 -0.880 -0.324 _KAENAEGQTPAIGPDGEPLDETSQMS(ph)DLPVK_
SMARCA4 Ubiquitylation K1283 0.125 _ILAAAK(gl)YK_
SMARCA4 Phosphorylation S1413 -0.265 0.515 _EVDYSDS(ph)LTEK_
SMARCA4 Phosphorylation S1486 -0.713 -0.935 _LS(ph)PNPPNLTK_
SOX2 Phosphorylation S251 0.157 -0.109 _SEASSS(ph)PPVVTSSSHSR_
SRC Phosphorylation S17 -0.604 -0.689 _S(ph)LEPAENVHGAGGGAFPASQTPSKPASADGHR_
SRC Phosphorylation S75 0.060 0.331 _LFGGFNSSDTVTS(ph)PQR_
TOP2B Ubiquitylation K205 0.226 _FTVETACK(gl)EYK_
TOP2B Ubiquitylation K221 -0.165 _QTWMNNMMK(gl)TSEAK_
TOP2B Ubiquitylation K373 -0.347 _AGVSVK(gl)PFQVK_
TOP2B Ubiquitylation K412 -0.274 _SFGSK(gl)CQLSEK_
TOP2B Ubiquitylation K550 0.643 _SYDDAESLK(gl)TLR_
TOP2B Ubiquitylation K643 -0.133 _GLGTSTAK(gl)EAK_
TOP2B Ubiquitylation K646 0.051 _EAK(gl)EYFADMER_
TOP2B Ubiquitylation K676 -0.188 _YAGPEDDAAITLAFSK(gl)K_
TOP2B Ubiquitylation K677 -0.188 _YAGPEDDAAITLAFSK(gl)K_
TOP2B Ubiquitylation K1079 0.700 _FILEK(gl)IQGK_
TOP2B Ubiquitylation K1227 -0.462 _K(gl)LQLEETMPSPYGR_
TOP2B Ubiquitylation K1250 -0.673 _RIIPEITAM(ox)K(gl)ADASK_
TOP2B Phosphorylation S1400 -0.221 -0.192 _VKAS(ph)PITNDGEDEFVPSDGLDKDEYTFSPGK_
TOP2B Phosphorylation T1403 -0.017 -0.156 _VKASPIT(ph)NDGEDEFVPSDGLDKDEYTFSPGK_
TOP2B Phosphorylation S1413 -0.430 -0.661 _ASPITNDGEDEFVPS(ph)DGLDKDEYTFSPGK_
TOP2B Phosphorylation T1422 -0.362 _VKAS(ph)PITNDGEDEFVPSDGLDKDEYT(ph)FSPGK_
TOP2B Phosphorylation S1424 -1.672 -1.441 _ASPITNDGEDEFVPSDGLDKDEYTFS(ph)PGK_
TOP2B Phosphorylation S1454 1.291 _KSQDFGNLFSFPSYS(ph)QK_
TOP2B Phosphorylation S1466 -0.324 -0.202 _FDS(ph)NEEDSASVFSPSFGLK_
TOP2B Phosphorylation S1552 2.808 _ASGS(ph)ENEGDYNPGRK_
TOP2B Phosphorylation S1581 -0.797 -1.005 _KTSFDQDS(ph)DVDIFPSDFPTEPPSLPR_
TWSG1 Ubiquitylation K192 1.435 _ISCESMGASK(gl)YR_
ZEB1 Ubiquitylation K77 0.237 _FTSLK(gl)EHIK_
ZEB1 Ubiquitylation K398 -0.697 0.131 _SEK(gl)LPEDLTVK_
ZEB1 Phosphorylation S713 -0.669 -0.753 _NNDQPQSANANEPQDSTVNLQS(ph)PLK_
ZEB1 Phosphorylation S1025 0.260 _REAEERDS(ph)TEQEEAGPEILSNEHVGAR_
ZEB1 Phosphorylation T1026 0.260 _REAEERDS(ph)TEQEEAGPEILSNEHVGAR_


© Copyright Svejstrup Laboratory 2015