bioLOGIC Data » bioLOGIC CategoryView » bioLOGIC VennView » Experimental Details »

bioLOGIC Data

bioLOGIC Data


Exact search


Query: ATRX

This is a cancer-associated gene according to the Sanger cancer gene census.

RNAi screen result RNAPII IP (PI) CSB IP CSB IP (PI) Chrom. Chrom. (PI) Phosphorylation Ubiquitylation
W
[Click on the plots to view the data selection in the respective scatterplot]

Protein Results:

 Results for post-translational modifications: see below | Red/green: hit at lower/upper end of the respective screen
Gene name Point score Z-score sums RNAi high RNAi low RNAPII-IP (PI) CSB-IP CSB-IP (PI) Chrom. Chrom. (PI)
ATRX 2 9.492 0.050 0.010 0.582 0.629

PTM Sites:

 Back to Protein Results | Red/green: hit at lower/upper end of the respective screen
Gene name PTM type PTM site UV UV (PI) Sequence
ATRX Phosphorylation S871 3.829 4.009 _NLKTS(ph)QEGSSDDAER_
ATRX Phosphorylation T887 1.203 1.421 _ET(ph)FSSAEGTVDKDTTIMELR_
ATRX Phosphorylation S1061 1.043 0.887 _KDELS(ph)DYAEK_
ATRX Phosphorylation S316 0.668 _VYEHTSRFS(ph)PK_
ATRX Phosphorylation S819 0.797 0.578 _RQTQSESSNYDS(ph)ELEKEIK_
ATRX Phosphorylation S313 0.766 0.451 _VYEHTS(ph)RFSPK_
ATRX Phosphorylation S1527 -0.080 0.235 _EVIEIEDAS(ph)PTKCPITTK_
ATRX Phosphorylation S596 0.021 _LTPVSLS(ph)NSPIKGADCQEVPQDKDGYK_
ATRX Phosphorylation S677 0.048 0.009 _RPTETNPVTSNS(ph)DEECNETVKEK_
ATRX Phosphorylation S34 -0.115 -0.055 _LHDFLAHSSEESEETSS(ph)PPR_
ATRX Phosphorylation S598 -0.157 -0.195 _LTPVSLSNS(ph)PIK_
ATRX Ubiquitylation K2182 -0.315 _QVTK(gl)QSLSFR_
ATRX Phosphorylation S92 -0.219 -0.386 _YVES(ph)DDEKPLDDETVNEDASNENSENDITMQSLPK_
ATRX Ubiquitylation K403 0.759 _SVLADIK(gl)K_
ATRX Ubiquitylation K404 0.759 _SVLADIK(gl)K_
ATRX Phosphorylation S889 0.942 _ETFS(ph)SAEGTVDKDTTIMELR_

Background Information for ATRX:


Pubmed-ATRX »
Uniprot-ATRX »
Biogrid-ATRX »
ProteomicsDB-ATRX »

Tumorportal-ATRX »
COSMIC-ATRX »
GenomeRNAi-ATRX »
Genecards-ATRX


Protein-protein Interactions for ATRX
Show screen data for Category Name and Description Link to cat description Data Source
Category members IP bait ATRX Cat. description Hein, Mann, Cell 2015
Category members IP bait CBX1 Cat. description Hein, Mann, Cell 2015
Category members IP bait CHAF1A Cat. description Hein, Mann, Cell 2015
Category members IP bait CNOT1 Cat. description Hein, Mann, Cell 2015
Category members IP bait CUL4A Cat. description Hein, Mann, Cell 2015
Category members IP bait DAXX Cat. description Hein, Mann, Cell 2015
Category members IP bait LRRK2 Cat. description Hein, Mann, Cell 2015
Category members IP bait MAD2L2 Cat. description Hein, Mann, Cell 2015
Category members IP bait SRP72 Cat. description Hein, Mann, Cell 2015
Category members IP bait TMPO Cat. description Hein, Mann, Cell 2015
Category members IP bait HIST1H4A Cat. description BioPlex, Huttlin, Gygi, Cell 2015
Category members IP bait WDR1 Cat. description BioPlex, Huttlin, Gygi, Cell 2015


Protein Domains in ATRX
Domain name Domain Description TC-NER relevance -log10(p-value)
Category members SNF2_N IPR000330 3.38
Category members P-loop_NTPase IPR027417 2.83
Category members Helicase_C IPR001650 2.48
Category members Helicase_ATP-bd IPR014001 2.48
Category members Znf_FYVE_PHD IPR011011 1.23


Protein complexes (CORUM database) featuring ATRX
Category Type Category ID Category Name Data Source TC-NER relevance -log10(p-value)
Category members Corum 2839 ATRX-DAXX complex Database 0.25
Category members Corum 2843 ATRX-DAXX complex Database 0.25


Categories featuring ATRX
Category Type Category ID Category Name Data Source TC-NER relevance -log10(p-value)
Category members GO Category GO:0005515 protein binding Database INF
Category members GO Category GO:0005634 nucleus Database INF
Category members GO Category GO:0006281 DNA repair Database INF
Category members GO Category GO:0003682 chromatin binding Database 6.07
Category members GO Category GO:0005524 ATP binding Database 5.54
Category members GO Category GO:0000792 heterochromatin Database 5.45
Category members Human mutations Sanger_cancer_genes Sanger cancer genes Database 4.88
Category members GO Category GO:0006310 DNA recombination Database 3.14
Category members GO Category GO:0004386 helicase activity Database 2.49
Category members GO Category GO:0003678 DNA helicase activity Database 2.22
Category members GO Category GO:0003677 DNA binding Database 1.53
Category members GO Category GO:0005720 nuclear heterochromatin Database 1.41
Category members GO Category GO:0032508 DNA duplex unwinding Database 1.24
Category members GO Category GO:0070087 chromo shadow domain binding Database 1.14
Category members GO Category GO:0000228 nuclear chromosome Database 0.89
Category members GO Category GO:0003676 nucleic acid binding Database 0.83
Category members GO Category GO:0008270 zinc ion binding Database 0.29
Category members GO Category GO:0006306 DNA methylation Database 0.22
Category members GO Category GO:0006355 regulation of transcription, DNA-dependent Database 0
Category members GO Category GO:0030900 forebrain development Database 0


.

© Copyright Svejstrup Laboratory 2015