bioLOGIC Data » bioLOGIC CategoryView » bioLOGIC VennView » Experimental Details »
bioLOGIC Category

Results for the Category
PID_RB_1PATHWAY
(Pathway_406)

RNAi screen result RNAPII IP (MG132) CSB IP CSB IP (MG132) Chrom. Chrom. (MG132) Ubi /Phospo Ubi /Phospho (MG132)
W

Protein Results:

Results for post-translational modifications (below)
Gene name MGoogle Score RNAi high RNAi low RNAPII-IP (MG132) CSB-IP CSB-IP (MG132) Chrom. Chrom. (MG132)
JUN 3 -0.930 0.930 -0.126
MAPK14 2 -0.160 -0.350
ATF2 2 -1.380 1.800
DNMT1 2 0.150 -0.150 0.077 -0.109 -1.422 0.572
DNMT1 2 0.150 -0.150 0.134 -0.347 -0.054
MAPK9 1 0.110 -0.490
SMARCB1 1 0.850 -0.060 0.041 -0.003 0.699 0.354 -0.731
SMARCB1 1 0.850 -0.060 0.738 1.594
CCND1 1 -1.820 3.470
HDAC1 1 -1.980 4.450
HDAC1 1 -1.980 4.450 -0.122 0.307 0.969 0.094 0.191
CCND2 1 1.210 -0.610
RAF1 1 2.020 -1.230
RBBP4 1 2.110 -1.240 0.533 -0.610 0.648
BRD2 1 0.290 -0.700 -0.698 -0.425 -0.090 -0.469 0.172
CREBBP 0 0.840 -0.950 -3.889 -1.071
E2F2 0 0.670 -1.180
MEF2C 0 -0.980 1.550
MEF2C 0 -0.980 1.550
SIRT1 0 0.910 -0.910
ABL1 0 0.670 -0.070
EP300 0 -1.210 1.320 -1.089 -1.694 -0.723
CCNE1 0 0.460 -0.980
CDK6 0 -0.190 0.160
CDK6 0 -0.190 0.160 -0.510 0.013
MET 0 -0.010 -0.330
UBTF 0 -0.020 0.110
UBTF 0 -0.020 0.110 0.507 0.155
UBTF 0 -0.020 0.110
E2F3 0 0.000 0.020
TBP 0 1.610 -1.170 -0.831
PPP2CA 0 0.160 -0.540 0.194 0.044 0.215
PPP2CA 0 0.160 -0.540 0.650 1.189
ELF1 0 0.320 -0.110
ELF1 0 0.320 -0.110
CDK2 0 -0.040 -0.300 -0.578 -0.797
CDK2 0 -0.040 -0.300 -0.202 -0.884 -0.107 -0.097 -0.501
CDKN1A 0 1.080 -0.750
RUNX2 0
SMARCA4 0 -0.810 1.520 0.629 -0.158 0.141 0.337 0.333
CDK4 0 1.930 -0.950
CDK4 0 1.930 -0.950 -0.510 0.013
MDM2 0 -0.210 0.080
RB1 0 1.180 -1.070 0.429 0.755
RB1 0 1.180 -1.070
CBX4 0 0.230 0.160 0.798 0.323
CCNA2 0 -0.530 0.260
SKP2 0 0.030 0.690
SKP2 0 0.030 0.690
TAF1 0 0.381 0.385
CDKN2A 0 -0.080 -0.260 -0.556 -1.080 -3.270 -1.110
CTBP1 0 -0.410 0.390
CTBP1 0 -0.410 0.390 -0.293 -0.875 0.361 0.407 -0.049
CTBP1 0 -0.410 0.390 1.494 -0.398 0.504 0.897 -0.123
ATF7 0 0.430 -0.390
HDAC3 0 -0.790 1.070
CEBPB 0 0.400 -0.930
TFDP1 0 -0.430 0.060 -1.111 0.446 -1.279 -0.496
E2F4 0 0.930 -0.810

PTM Sites:

Back to Protein Results
Gene name PTM type PTM site UV UV (MG132) Sequence
ABL1 Phosphorylation S1083 -1.131 -0.857 _GQGESDPLDHEPAVS(ph)PLLPR_
ABL1 Phosphorylation S1134 0.293 _SSS(ph)FREMDGQPER_
ABL1 Phosphorylation S1232 0.821 0.183 _SCS(ph)ASCVPHGAK_
ATF2 Phosphorylation T71 -1.263 -1.166 _NDSVIVADQTPT(ph)PTR_
ATF2 Phosphorylation S90 2.624 2.389 _NCEEVGLFNELAS(ph)PFENEFKK_
ATF2 Phosphorylation S112 1.025 1.118 _MPLDLS(ph)PLATPIIR_
ATF7 Phosphorylation T51 0.016 _TDSVIIADQT(ph)PTPTR_
ATF7 Phosphorylation T53 0.151 0.259 _TDSVIIADQTPT(ph)PTR_
ATF7 Phosphorylation S259 -0.723 -1.674 _PVSMVPNIPGIPGPPVNSSGSISPS(ph)GHPIPSEAK_
BRD2 Phosphorylation T6 -1.061 _(ac)MLQNVT(ph)PHNKLPGEGNAGLLGLGPEAAAPGK_
BRD2 Phosphorylation Y40 -0.551 -2.307 _KPSLLY(ph)EGFESPTMASVPALQLTPANPPPPEVSNPK_
BRD2 Ubiquitylation K127 -0.468 _QPMDMGTIK(gl)R_
BRD2 Phosphorylation S298 -1.632 -2.577 _ADTTTPTPTAILAPGS(ph)PASPPGSLEPK_
BRD2 Phosphorylation S301 -2.332 -1.336 _ADTTTPTPTAILAPGSPAS(ph)PPGSLEPK_
BRD2 Phosphorylation S334 2.077 _DLPDS(ph)QQQHQSSK_
BRD2 Phosphorylation T664 -0.812 _TAPPALPT(ph)GYDSEEEEESRPMSYDEK_
BRD2 Phosphorylation S668 -0.759 -0.843 _TAPPALPTGYDS(ph)EEEEESRPMSYDEK_
CBX4 Phosphorylation S291 0.263 0.125 _SGEVAEGEARS(ph)PSHKK_
CBX4 Phosphorylation S293 0.227 _SGEVAEGEARSPS(ph)HKK_
CCNA2 Ubiquitylation K54 -0.746 _AALAVLK(gl)SGNPR_
CCNA2 Ubiquitylation K68 -1.274 _GLAQQQRPK(gl)TR_
CCND1 Ubiquitylation K33 -0.490 _AMLK(gl)AEETCAPSVSYFK_
CCND1 Ubiquitylation K46 -1.016 -0.036 _AEETCAPSVSYFK(gl)CVQK_
CCND1 Ubiquitylation K95 -0.733 -0.137 _FLSLEPVK(gl)K_
CCND1 Ubiquitylation K96 -0.846 -0.155 _FLSLEPVKK(gl)_
CCND1 Ubiquitylation K238 0.245 _VIK(gl)CDPDCLR_
CCND2 Ubiquitylation K45 -0.759 -0.277 _YLPQCSYFK(gl)CVQK_
CCND2 Ubiquitylation K49 -0.524 _CVQK(gl)DIQPYMR_
CCND2 Ubiquitylation K113 -0.572 _LK(gl)ETSPLTAEK_
CCND2 Ubiquitylation K173 -1.137 0.202 _EK(gl)LSLIR_
CCND2 Phosphorylation S269 0.049 _DGS(ph)KSEDELDQASTPTDVR_
CCND2 Phosphorylation S271 2.155 _DGSKS(ph)EDELDQASTPTDVR_
CCNE1 Phosphorylation S100 -0.765 _IIAPS(ph)RGSPLPVLSWANR_
CCNE1 Phosphorylation S103 -0.765 _IIAPS(ph)RGSPLPVLSWANR_
CCNE1 Phosphorylation S387 0.705 -0.922 _AS(ph)PLPSGLLTPPQSGK_
CDK2 Ubiquitylation K6 -0.130 -0.399 _(ac)MENFQK(gl)VEK_
CDK2 Ubiquitylation K6 0.011 -0.784 _(ac)M(ox)EDYTK(gl)IEK_
CDK2 Phosphorylation T14 0.429 _IGEGT(ph)YGVVYK_
CDK2 Phosphorylation Y15 0.697 0.743 _IGEGTY(ph)GVVYK_
CDK2 Ubiquitylation K20 0.272 _IGEGTYGVVYK(gl)AR_
CDK2 Ubiquitylation K20 -0.327 -0.270 _IGEGTYGVVYK(gl)GR_
CDK2 Ubiquitylation K24 0.366 _NK(gl)LTGEVVALKK_
CDK2 Ubiquitylation K33 0.033 _NKLTGEVVALK(gl)K_
CDK2 Ubiquitylation K33 0.736 0.239 _TTGQVVAMK(gl)K_
CDK2 Ubiquitylation K34 0.542 _LTGEVVALKK(gl)_
CDK2 Ubiquitylation K34 -0.306 _TTGQVVAMKK(gl)_
CDK2 Ubiquitylation K58 0.312 -0.262 _EISLLK(gl)ELR_
CDK2 Ubiquitylation K136 -0.468 _DLK(gl)PQNLLIDDK(gl)GTIK_
CDK2 Ubiquitylation K145 0.161 -0.954 _DLKPQNLLIDDK(gl)GTIK_
CDK2 Ubiquitylation K149 -0.038 _GTIK(gl)LADFGLAR_
CDK2 Ubiquitylation K251 -0.047 -1.236 _WK(gl)PGSLASHVK_
CDK2 Ubiquitylation K280 0.179 -1.210 _MLIYDPAK(gl)R_
CDK2 Ubiquitylation K298 -1.907 -2.380 _QDFSK(gl)VVPPLDEDGR_
CDK4 Ubiquitylation K142 -0.552 _DLK(gl)PENILVTSGGTVK_
CDK4 Ubiquitylation K211 -0.101 _K(gl)PLFCGNSEADQLGK_
CDK4 Phosphorylation S236 0.095 _QDDS(ph)PSGASYGQDYDLS(ph)PSR_
CDK4 Phosphorylation S249 0.095 _QDDS(ph)PSGASYGQDYDLS(ph)PSR_
CDK4 Ubiquitylation K297 0.247 0.052 _ALQHSYLHK(gl)DEGNPE_
CDK4 Phosphorylation S385 0.649 _HSSIS(ph)PVRLPLNSSLGAELSR_
CDK4 Phosphorylation S420 0.004 -0.202 _ES(ph)KGSPVFLPR_
CDK4 Phosphorylation S423 -0.155 -0.297 _GS(ph)PVFLPR_
CDK4 Phosphorylation T514 0.364 0.570 _DSKPIALKEEIVT(ph)PK_
CDK4 Phosphorylation S681 -2.532 -2.051 _HLLTDLPLPPELPGGDLS(ph)PPDS(ph)PEPK_
CDK4 Phosphorylation S685 -2.729 _HLLTDLPLPPELPGGDLS(ph)PPDS(ph)PEPK_
CDK4 Phosphorylation T692 -0.765 -1.849 _AIT(ph)PPQQPYK_
CDK4 Phosphorylation S1082 -1.661 -0.980 _KETTSGTSTEPVKNS(ph)SPAPPQPAPGK_
CDK4 Phosphorylation S1083 -1.093 -1.330 _NSS(ph)PAPPQPAPGK_
CDK4 Phosphorylation T1244 -0.956 _RT(ph)PTMPQEEAAACPPHILPPEK_
CDK6 Ubiquitylation K3 0.121 0.039 _(ac)MEK(gl)DGLCR_
CDK6 Phosphorylation S236 0.095 _QDDS(ph)PSGASYGQDYDLS(ph)PSR_
CDK6 Phosphorylation S249 0.095 _QDDS(ph)PSGASYGQDYDLS(ph)PSR_
CDK6 Phosphorylation S385 0.649 _HSSIS(ph)PVRLPLNSSLGAELSR_
CDK6 Phosphorylation S420 0.004 -0.202 _ES(ph)KGSPVFLPR_
CDK6 Phosphorylation S423 -0.155 -0.297 _GS(ph)PVFLPR_
CDK6 Phosphorylation T514 0.364 0.570 _DSKPIALKEEIVT(ph)PK_
CDK6 Phosphorylation S681 -2.532 -2.051 _HLLTDLPLPPELPGGDLS(ph)PPDS(ph)PEPK_
CDK6 Phosphorylation S685 -2.729 _HLLTDLPLPPELPGGDLS(ph)PPDS(ph)PEPK_
CDK6 Phosphorylation T692 -0.765 -1.849 _AIT(ph)PPQQPYK_
CDK6 Phosphorylation S1082 -1.661 -0.980 _KETTSGTSTEPVKNS(ph)SPAPPQPAPGK_
CDK6 Phosphorylation S1083 -1.093 -1.330 _NSS(ph)PAPPQPAPGK_
CDK6 Phosphorylation T1244 -0.956 _RT(ph)PTMPQEEAAACPPHILPPEK_
CDKN1A Ubiquitylation K188 -2.505 -1.077 _QTSMTDFYHSK(gl)R_
CEBPB Phosphorylation S231 -0.660 _AYLGYQAVPSGSSGSLSTSSSSS(ph)PPGTPSPADAK_
CREBBP Phosphorylation S2093 0.037 0.097 _SIS(ph)PSALQDLLR_
CTBP1 Ubiquitylation K279 0.443 _GGLVDEK(gl)ALAQALK_
CTBP1 Ubiquitylation K286 0.130 0.008 _ALAQALK(gl)EGR_
CTBP1 Phosphorylation S492 -1.548 _YPPGIVGVAPGGLPAAM(ox)EGIIPGGIPVTHNLPTVAHPS(ph)QAPSPNQPTK_
DNMT1 Phosphorylation S127 -0.755 -0.836 _VGM(ox)ADANS(ph)PPKPLSKPR_
DNMT1 Phosphorylation S143 0.877 0.220 _SKS(ph)DGEAKPEPSPSPR_
DNMT1 Phosphorylation S152 -0.685 -1.347 _SDGEAKPEPS(ph)PSPR_
DNMT1 Phosphorylation S154 -1.926 -0.876 _SDGEAKPEPSPS(ph)PR_
DNMT1 Ubiquitylation K586 1.686 3.368 _DLIK(gl)LAGVTLGQR_
DNMT1 Ubiquitylation K675 1.267 0.915 _DMVK(gl)FGGSGR_
DNMT1 Phosphorylation S714 -0.773 -0.554 _EADDDEEVDDNIPEMPS(ph)PKK_
DNMT1 Phosphorylation S954 -0.318 0.057 _LSS(ph)PVKRPR_
DNMT1 Ubiquitylation K961 -3.166 _K(gl)EPVDEDLYPEHYR_
DNMT1 Ubiquitylation K981 -0.298 -1.482 _YSDYIK(gl)GSNLDAPEPYR_
DNMT1 Ubiquitylation K997 0.042 0.154 _IK(gl)EIFCPK_
DNMT1 Ubiquitylation K1483 1.983 -0.103 _GVCSCVEAGK(gl)ACDPAAR_
E2F2 Ubiquitylation K188 -0.267 _TRYDTSLGLLTK(gl)K_
E2F2 Ubiquitylation K189 -0.267 _TRYDTSLGLLTK(gl)K_
E2F3 Ubiquitylation K188 -0.267 _TRYDTSLGLLTK(gl)K_
E2F3 Ubiquitylation K189 -0.267 _TRYDTSLGLLTK(gl)K_
E2F4 Phosphorylation T14 -2.100 _(ac)AEAGPQAPPPPGT(ph)PSR_
E2F4 Phosphorylation S16 -2.158 -1.655 _(ac)AEAGPQAPPPPGTPS(ph)R_
ELF1 Phosphorylation S163 -0.466 _YADS(ph)PGASSPEQPK_
ELF1 Phosphorylation S167 -0.658 _YADSPGAS(ph)SPEQPKR_
ELF1 Phosphorylation S187 -1.065 -1.182 _TKPPRPDS(ph)PATTPNISVK_
ELF1 Phosphorylation T190 -0.967 _TKPPRPDSPAT(ph)TPNISVK_
ELF1 Ubiquitylation K280 -0.045 _GILAK(gl)VEGQR_
EP300 Phosphorylation S1038 -0.672 -0.349 _TEIKEEEDQPSTSATQSS(ph)PAPGQSK_
EP300 Phosphorylation S1726 0.994 0.627 _LGLGLDDESNNQQAAATQS(ph)PGDSRR_
EP300 Phosphorylation S2328 -1.092 0.725 _PQSQPPHSSPS(ph)PR_
HDAC1 Ubiquitylation K50 0.036 _K(gl)MEIYRPHK_
HDAC1 Ubiquitylation K66 -0.593 _ANAEEMTK(gl)YHSDDYIK_
HDAC1 Ubiquitylation K74 0.620 -1.473 _YHSDDYIK(gl)FLR_
HDAC1 Ubiquitylation K89 0.749 -0.241 _SIRPDNMSEYSK(gl)QMQR_
HDAC1 Phosphorylation S393 -1.133 -1.144 _M(ox)LPHAPGVQM(ox)QAIPEDAIPEES(ph)GDEDEDDPDKR_
HDAC1 Phosphorylation S409 1.326 1.144 _ISICS(ph)SDKR_
HDAC1 Phosphorylation S410 1.326 1.144 _ISICS(ph)SDKR_
HDAC1 Ubiquitylation K412 0.642 -0.744 _ISICSSDK(gl)R_
HDAC3 Phosphorylation S424 -0.354 _GPEENYSRPEAPNEFYDGDHDNDKES(ph)DVEI_
JUN Phosphorylation S58 -0.167 -1.247 _AKNS(ph)DLLTSPDVGLLK_
JUN Phosphorylation T62 2.545 1.674 _NSDLLT(ph)SPDVGLLK_
JUN Phosphorylation S63 2.030 1.458 _NSDLLTS(ph)PDVGLLK_
JUN Ubiquitylation K70 9.213 _NSDLLTSPDVGLLK(gl)_
JUN Phosphorylation S73 1.499 0.845 _LAS(ph)PELER_
JUN Phosphorylation S243 -0.642 -1.399 _LQALKEEPQTVPEMPGETPPLS(ph)PIDMESQER_
JUN Ubiquitylation K309 1.034 0.155 _EQVAQLK(gl)QK_
MAPK14 Phosphorylation S2 3.221 3.623 _(ac)S(ph)QERPTFYR_
MAPK14 Phosphorylation T180 0.958 1.087 _HTDDEM(ox)T(ph)GYVATR_
MAPK14 Phosphorylation Y182 1.388 1.374 _HTDDEM(ox)TGY(ph)VATR_
MAPK14 Ubiquitylation K249 0.073 -1.380 _LVGTPGAELLKK(gl)_
MAPK9 Phosphorylation Y185 3.533 _TACTNFMMTPY(ph)VVTR_
MDM2 Phosphorylation S166 0.576 1.068 _AIS(ph)ETEENSDELSGER_
MDM2 Ubiquitylation K334 -0.872 _ENWLPEDK(gl)GK_
MDM2 Ubiquitylation K336 -0.872 _ENWLPEDK(gl)GK_
MDM2 Ubiquitylation K363 0.883 _LENSTQAEEGFDVPDCK(gl)K_
MDM2 Ubiquitylation K364 0.883 _LENSTQAEEGFDVPDCK(gl)K_
MDM2 Ubiquitylation K473 0.806 _NK(gl)PCPVCR_
MEF2C Ubiquitylation K23 -0.140 _QVTFTK(gl)R_
MEF2C Phosphorylation S240 0.008 0.302 _NS(ph)PGLLVSPGNLNK_
MEF2C Phosphorylation S406 0.272 0.338 _SEPVS(ph)PPRDR_
MET Ubiquitylation K962 0.146 _QIK(gl)DLGSELVR_
MET Phosphorylation S988 0.064 _S(ph)VSPTTEM(ox)VSNESVDYR_
MET Phosphorylation S990 0.192 -0.105 _SVS(ph)PTTEM(ox)VSNESVDYR_
MET Phosphorylation T992 0.501 -0.048 _SVSPT(ph)TEMVSNESVDYR_
MET Phosphorylation S997 0.285 _S(ph)VSPTTEMVS(ph)NESVDYR_
PPP2CA Ubiquitylation K4 -0.788 -0.378 _(ac)MDDK(gl)AFTK_
PPP2CA Ubiquitylation K4 -0.450 -0.016 _(ac)M(ox)DEK(gl)VFTK_
PPP2CA Ubiquitylation K8 -0.522 _VFTK(gl)ELDQWIEQLNECK_
PPP2CA Ubiquitylation K21 -1.370 _ELDQWVEQLNECK(gl)QLNENQVR_
PPP2CA Ubiquitylation K21 -1.106 _ELDQWIEQLNECK(gl)QLSESQVK_
PPP2CA Ubiquitylation K29 0.211 0.122 _QLSESQVK(gl)SLCEK_
PPP2CA Ubiquitylation K36 -0.455 0.187 _AK(gl)EILTK_
PPP2CA Ubiquitylation K36 -0.455 0.187 _AK(gl)EILTK_
PPP2CA Ubiquitylation K41 -0.049 0.003 _EILTK(gl)ESNVQEVR_
PPP2CA Ubiquitylation K74 -0.316 -0.316 _IGGK(gl)SPDTNYLFMGDYVDR_
RAF1 Phosphorylation S29 0.028 -0.571 _DAVFDGSSCIS(ph)PTIVQQFGYQR_
RAF1 Phosphorylation T31 0.028 -0.669 _DAVFDGSSCIS(ph)PTIVQQFGYQR_
RAF1 Phosphorylation S244 0.053 _YSTPHAFTFNTSS(ph)PSSEGSLSQR_
RAF1 Phosphorylation S259 -0.069 0.054 _STS(ph)TPNVHM(ox)VSTTLPVDSR_
RAF1 Phosphorylation S301 -0.651 _SHSESASPSALSSSPNNLS(ph)PTGWSQPK_
RAF1 Phosphorylation T303 -0.664 _SHSESASPSALSSSPNNLSPT(ph)GWSQPK_
RAF1 Phosphorylation S497 -0.449 _SRWS(ph)GSQQVEQPTGSVLWMAPEVIR_
RAF1 Phosphorylation S621 0.212 0.271 _SAS(ph)EPSLHR_
RAF1 Phosphorylation S642 -0.197 0.463 _AAHTEDINACTLTTS(ph)PR_
RB1 Phosphorylation S69 -3.602 -3.397 _TAATAAAAAAEPPAPPPPPPPEEDPEQDS(ph)GPEDLPLVR_
RB1 Ubiquitylation K97 -0.546 _LK(gl)IPDHVR_
RB1 Phosphorylation T388 0.005 0.116 _TLQTDSIDSFETQRT(ph)PR_
RB1 Phosphorylation T405 -0.851 -0.901 _KSNLDEEVNVIPPHT(ph)PVR_
RB1 Phosphorylation S820 -0.019 _S(ph)PYKFPSSPLR_
RB1 Ubiquitylation K823 -2.214 _SPYK(gl)FPSSPLR_
RB1 Phosphorylation S827 0.824 0.111 _FPSS(ph)PLR_
RB1 Phosphorylation S839 -0.701 -1.045 _IPGGNIYIS(ph)PLKS(ph)PYK_
RB1 Ubiquitylation K842 -0.751 _IPGGNIYISPLK(gl)SPYK_
RB1 Phosphorylation S843 -0.701 -0.022 _IPGGNIYIS(ph)PLKS(ph)PYK_
RB1 Ubiquitylation K846 -2.084 _SPYK(gl)ISEGLPTPTK_
RB1 Phosphorylation T853 0.039 -0.555 _ISEGLPT(ph)PTKM(ox)T(ph)PR_
RB1 Ubiquitylation K856 -1.350 _ISEGLPTPTK(gl)MTPR_
RB1 Phosphorylation T858 -0.782 0.564 _ISEGLPT(ph)PTKMT(ph)PR_
RB1 Ubiquitylation K879 -0.187 _FQK(gl)INQMVCNSDR_
RBBP4 Ubiquitylation K4 0.699 0.574 _(ac)ADK(gl)EAAFDDAVEER_
RBBP4 Ubiquitylation K160 -1.765 _HPSK(gl)PDPSGECNPDLR_
RUNX2 Phosphorylation S96 0.504 -0.399 _RFS(ph)PPSSSLQPGK_
RUNX2 Ubiquitylation K244 0.258 _NASAVMK(gl)NQVAR_
SIRT1 Phosphorylation S14 -0.369 -0.246 _(ac)ADEAALALQPGGS(ph)PSAAGADR_
SIRT1 Phosphorylation S16 -0.306 -1.665 _(ac)ADEAALALQPGGS(ph)PS(ph)AAGADREAASSPAGEPLR_
SIRT1 Phosphorylation S26 -1.047 -0.245 _EAAS(ph)SPAGEPLR_
SIRT1 Phosphorylation S27 0.351 -0.363 _EAASS(ph)PAGEPLR_
SIRT1 Phosphorylation S47 -0.574 -0.607 _S(ph)PGEPGGAAPER_
SIRT1 Ubiquitylation K238 -1.641 _RK(gl)DINTIEDAVK_
SIRT1 Ubiquitylation K499 -2.138 -0.204 _LGGEYAK(gl)LCCNPVK_
SIRT1 Ubiquitylation K578 -2.782 _GCMEEK(gl)PQEVQTSR_
SIRT1 Ubiquitylation K601 -3.051 _NVESIAEQMENPDLK(gl)NVGSSTGEK_
SKP2 Phosphorylation S8 -1.062 _SNLGHPES(ph)PPRK_
SKP2 Phosphorylation S64 -1.144 -1.189 _EEPDSENIPQELLSNLGHPES(ph)PPR_
SKP2 Phosphorylation S75 0.512 0.657 _SKGS(ph)DKDFVIVR_
SKP2 Ubiquitylation K228 -0.475 _LSDPIVNTLAK(gl)NSNLVR_
SKP2 Ubiquitylation K420 -1.178 _LTLQK(gl)PSCL_
SMARCA4 Ubiquitylation K357 -0.934 _ITPIQK(gl)PR_
SMARCA4 Ubiquitylation K405 0.109 1.148 _ATIELK(gl)ALR_
SMARCA4 Ubiquitylation K437 -0.317 _DTALETALNAK(gl)AYKR_
SMARCA4 Ubiquitylation K455 0.225 _ITEK(gl)LEK_
SMARCA4 Ubiquitylation K496 0.923 _SVTGK(gl)IQK_
SMARCA4 Phosphorylation S677 -0.880 -0.324 _KAENAEGQTPAIGPDGEPLDETSQMS(ph)DLPVK_
SMARCA4 Ubiquitylation K1283 0.125 _ILAAAK(gl)YK_
SMARCA4 Phosphorylation S1413 -0.265 0.515 _EVDYSDS(ph)LTEK_
SMARCA4 Phosphorylation S1486 -0.713 -0.935 _LS(ph)PNPPNLTK_
SMARCB1 Ubiquitylation K13 0.411 -0.949 _TFGQK(gl)PVK_
SMARCB1 Ubiquitylation K208 -0.170 _LDMEIDGQK(gl)LR_
TAF1 Phosphorylation S547 -1.176 _LLEPPVLTLDPNDENLILEIPDEKEEATSNSPS(ph)K_
TAF1 Phosphorylation S550 -1.343 _LLEPPVLTLDPNDENLILEIPDEKEEATSNSPSKES(ph)K_
TAF1 Phosphorylation S1176 0.662 1.114 _DDDTASVTS(ph)LNSSATGR_
TAF1 Phosphorylation T1703 0.001 -0.298 _DASVFQDESNM(ox)SVLDIPSAT(ph)PEK_
TBP Ubiquitylation K181 -0.140 -0.577 _LDLK(gl)TIALR_
TBP Ubiquitylation K225 -0.596 _MVCTGAK(gl)SEEQSR_
TFDP1 Phosphorylation S23 -0.667 -0.353 _VFIDQNLS(ph)PGK_
TFDP1 Ubiquitylation K320 -0.549 0.052 _MGMACGLESGSCSAEDLK(gl)MAR_
UBTF Ubiquitylation K45 0.246 _NNLPSNDSSK(gl)FK_
UBTF Ubiquitylation K47 0.246 _NNLPSNDSSK(gl)FK_
UBTF Ubiquitylation K71 0.458 0.860 _LK(gl)WVEISNEVR_
UBTF Ubiquitylation K284 0.940 _STLTK(gl)AER_
UBTF Phosphorylation S484 1.431 0.191 _GKLPES(ph)PKR_


© Copyright Svejstrup Laboratory 2015