bioLOGIC Data » bioLOGIC CategoryView » bioLOGIC VennView » Experimental Details »
bioLOGIC Data

bioLOGIC Data


Exact search

Query: BRD2

RNAi screen result RNAPII IP (PI) CSB IP CSB IP (PI) Chrom. Chrom. (PI) Phosphorylation Ubiquitylation
W
[Click on the plots to view the data selection in the respective scatterplot]

Protein Results:

Results for post-translational modifications: see below | Red/green: hit at lower/upper end of the respective screen
Gene name Point score Z-score sums RNAi high RNAi low RNAPII-IP (PI) CSB-IP CSB-IP (PI) Chrom. Chrom. (PI)
BRD2 1 -0.452 0.290 -0.700 -0.698 -0.425 -0.090 -0.469 0.172

PTM Sites:

Back to Protein Results | Red/green: hit at lower/upper end of the respective screen
Gene name PTM type PTM site UV UV (PI) Sequence
BRD2 Phosphorylation S334 2.077 _DLPDS(ph)QQQHQSSK_
BRD2 Ubiquitylation K127 -0.468 _QPMDMGTIK(gl)R_
BRD2 Phosphorylation T664 -0.812 _TAPPALPT(ph)GYDSEEEEESRPMSYDEK_
BRD2 Phosphorylation S668 -0.759 -0.843 _TAPPALPTGYDS(ph)EEEEESRPMSYDEK_
BRD2 Phosphorylation T6 -1.061 _(ac)MLQNVT(ph)PHNKLPGEGNAGLLGLGPEAAAPGK_
BRD2 Phosphorylation S301 -2.332 -1.336 _ADTTTPTPTAILAPGSPAS(ph)PPGSLEPK_
BRD2 Phosphorylation Y40 -0.551 -2.307 _KPSLLY(ph)EGFESPTMASVPALQLTPANPPPPEVSNPK_
BRD2 Phosphorylation S298 -1.632 -2.577 _ADTTTPTPTAILAPGS(ph)PASPPGSLEPK_

Background Information for BRD2:





Protein-protein Interactions for BRD2

Show screen data for Category Name and Description Link to cat description Data Source
Category members IP bait BRD3 Cat. description BioPlex, Huttlin, Gygi, Cell 2015
Category members IP bait CAMKV Cat. description BioPlex, Huttlin, Gygi, Cell 2015
Category members IP bait DENND2D Cat. description BioPlex, Huttlin, Gygi, Cell 2015
Category members IP bait EPB41L5 Cat. description BioPlex, Huttlin, Gygi, Cell 2015
Category members IP bait FAM90A1 Cat. description BioPlex, Huttlin, Gygi, Cell 2015
Category members IP bait MDK Cat. description BioPlex, Huttlin, Gygi, Cell 2015
Category members IP bait PES1 Cat. description BioPlex, Huttlin, Gygi, Cell 2015
Category members IP bait PIP4K2A Cat. description BioPlex, Huttlin, Gygi, Cell 2015


Protein Domains in BRD2

Domain name Domain Description TC-NER relevance -log10(p-value)
Category members Bromodomain IPR001487 1.43


Protein complexes (CORUM database) featuring BRD2

Category Type Category ID Category Name Data Source TC-NER relevance -log10(p-value)


Categories featuring BRD2

Category Type Category ID Category Name Data Source TC-NER relevance -log10(p-value)
Category members GO Category GO:0005515 protein binding Database INF
Category members Pathway Pathway_406 PID_RB_1PATHWAY 0 0.21


© Copyright Svejstrup Laboratory 2015