bioLOGIC Data » bioLOGIC CategoryView » bioLOGIC VennView » Experimental Details »
bioLOGIC Category

Results for the Category
tight junction
(GO:0005923)

RNAi screen result RNAPII IP (MG132) CSB IP CSB IP (MG132) Chrom. Chrom. (MG132) Ubi /Phospo Ubi /Phospho (MG132)
W

Protein Results:

Results for post-translational modifications (below)
Gene name MGoogle Score RNAi high RNAi low RNAPII-IP (MG132) CSB-IP CSB-IP (MG132) Chrom. Chrom. (MG132)
PARD3 3 -1.810 4.070 0.910
PARD3 3 -1.810 4.070
PARD3 3 -1.810 4.070 0.184 0.180
YBX2 2 0.320 -0.460 0.674 0.402 -1.244 -0.405
DLG3 2 0.180 -1.120 1.552 0.102 0.488
DLG3 2 0.180 -1.120
TJP1 2 -0.410 1.150
TJP1 2 -0.410 1.150 -0.039 -0.011
TJP1 2 -0.410 1.150
MTDH 2 0.690 -0.240 0.222 0.258
AMOTL1 2 -1.540 3.320 0.614 0.467 0.043
AMOTL1 2 -1.540 3.320
DLG1 1 0.400 -0.220 1.552 0.102 0.488
VAPA 1 -2.350 3.970 -2.551 0.014 0.056
CCND1 1 -1.820 3.470
STRN 1 -0.950 1.240 2.466 0.374 0.242
PARD3B 1 2.150 -1.090
ARHGEF2 1 -0.650 0.360 -0.121 -0.287 0.319 0.984 0.013
VASP 1 0.180 0.270 1.849
CXADR 1 -0.550 1.230 0.333 1.691
PRKCZ 0 -0.290 0.310
MPP5 0 -0.550 1.720 0.158 0.229 -0.737
TRAF4 0 -0.140 0.360
MAGI3 0 1.510 -0.840
MAGI3 0 1.510 -0.840 0.696 0.967
LIN7B 0 0.200 0.140 0.413 0.576 0.542
TGFBR1 0 -0.260 0.020
MPDZ 0 -0.900 0.940 0.139 -0.579
LIN7A 0 0.450 -0.640
LIN7A 0 0.450 -0.640 0.413 0.576 0.542
ECT2 0 0.620 -0.960 -0.787
ASH1L 0 1.230 -0.360 -0.777 -0.350
UBN1 0 1.460 -0.610
TJP2 0 0.160 0.070 -1.237 -1.460
TJP2 0 0.160 0.070 0.144 0.035 0.024
EPCAM 0 0.440 -0.510
PARD6B 0 -1.070 1.470
SYMPK 0 -0.610 1.280 -0.489 0.051 -0.040 -0.388 0.104
AMOT 0 1.330 -0.510 0.614 0.467 0.043
AMOT 0 1.330 -0.510
CGNL1 0 0.110 -0.430
INADL 0 -1.520 2.140 1.064 0.331
CDK4 0 1.930 -0.950
CDK4 0 1.930 -0.950 -0.510 0.013
TJAP1 0 -0.540 -0.200
ARHGAP17 0 1.130 -0.670
MARVELD3 0 1.530 -0.990
TBCD 0 0.820 -0.650 1.428
CGN 0 -0.850 0.720 0.110 0.304
RAB10 0 -0.280 -0.200 1.641 -1.484 0.560 0.491
SHROOM2 0 1.900 -1.500
LIN7C 0 0.413 0.576 0.542
LIN7C 0
MPP7 0 0.640 -0.320 1.118 0.576
ANK3 0 0.110 -0.340
ANK3 0 0.110 -0.340 -0.060 1.268 0.717
MAGI1 0 -0.840 1.740 0.696 0.967
JAM2 0 0.170 0.960
CLDN12 0 -1.170 1.910
F11R 0 -0.710 0.530 0.514 0.505
CLDN1 0 -0.240 -0.450
JAM3 0 0.860 -0.200 0.644 0.464
NHS 0 0.290 -0.270
OCLN 0 1.360 -0.180 0.052 0.302
OCLN 0 1.360 -0.180
CCDC85C 0 0.000 0.220
CCDC85C 0 0.320 -0.860

PTM Sites:

Back to Protein Results
Gene name PTM type PTM site UV UV (MG132) Sequence
AMOT Ubiquitylation K94 -0.138 _QEPQGQEIQSENLIMEK(gl)QLSPR_
AMOT Ubiquitylation K113 -0.211 0.313 _MQNNEELPTYEEAK(gl)VQSQYFR_
AMOT Ubiquitylation K503 -0.204 _NK(gl)LEGEIR_
AMOT Phosphorylation S712 0.161 0.250 _DTTVIS(ph)HSPNTSYDTALEAR_
AMOT Phosphorylation S714 0.324 0.183 _DTTVISHS(ph)PNTSYDTALEAR_
AMOTL1 Ubiquitylation K94 -0.138 _QEPQGQEIQSENLIMEK(gl)QLSPR_
AMOTL1 Ubiquitylation K113 -0.211 0.313 _MQNNEELPTYEEAK(gl)VQSQYFR_
AMOTL1 Ubiquitylation K174 -0.710 _QEPQGQEHQVDNTVMEK(gl)QVR_
AMOTL1 Ubiquitylation K227 0.218 _GQQQQQQQQGAVGHGYYMAGGTSQK(gl)SR_
AMOTL1 Ubiquitylation K251 -0.083 _ANSGQAHKDEALK(gl)ELK_
AMOTL1 Phosphorylation S269 0.526 _IMQLS(ph)LER_
AMOTL1 Ubiquitylation K302 -1.446 -1.374 _VGGGPSPAQPAGK(gl)VLDPR_
AMOTL1 Ubiquitylation K316 -0.341 _GPPPEYPFK(gl)TK_
AMOTL1 Ubiquitylation K318 0.088 0.953 _TK(gl)QMMSPVSK_
AMOTL1 Ubiquitylation K474 1.416 1.608 _FEK(gl)ELQR_
AMOTL1 Ubiquitylation K503 -0.204 _NK(gl)LEGEIR_
AMOTL1 Ubiquitylation K625 1.158 1.703 _LQQALTQLQSACEK(gl)R_
AMOTL1 Phosphorylation S712 0.161 0.250 _DTTVIS(ph)HSPNTSYDTALEAR_
AMOTL1 Phosphorylation S714 0.324 0.183 _DTTVISHS(ph)PNTSYDTALEAR_
AMOTL1 Phosphorylation S720 0.743 0.380 _DTTIINHS(ph)R_
ANK3 Phosphorylation S1405 0.434 0.363 _IRDTS(ph)QEPCGR_
ANK3 Phosphorylation S1459 0.743 0.188 _RQS(ph)FASLALR_
ANK3 Phosphorylation S1462 0.189 _RYS(ph)YLTEPGMSPQSPCER_
ANK3 Phosphorylation S4298 0.236 0.621 _IHGSGHVEEPAS(ph)PLAAYQK_
ARHGAP17 Phosphorylation S575 -1.453 -1.313 _AESSSGGGTVPSSAGILEQGPSPGDGS(ph)PPKPK_
ARHGAP17 Phosphorylation S676 -1.792 _SPS(ph)PPTQHTGQPPGQPSAPSQLSAPR_
ARHGAP17 Phosphorylation T682 -2.462 _SPSPPTQHT(ph)GQPPGQPSAPSQLSAPR_
ARHGEF2 Phosphorylation S196 -0.074 0.190 _SVS(ph)TTNIAGHFNDESPLGLR_
ARHGEF2 Phosphorylation S208 -1.192 _SVSTTNIAGHFNDES(ph)PLGLR_
ARHGEF2 Phosphorylation S217 0.850 _ILS(ph)QSTDSLNMR_
ARHGEF2 Phosphorylation S219 0.334 0.620 _ILSQS(ph)TDSLNMR_
ARHGEF2 Ubiquitylation K397 -0.617 _LYK(gl)ELYAR_
ARHGEF2 Phosphorylation S689 2.510 1.206 _SES(ph)LESPR_
ARHGEF2 Phosphorylation S735 -0.212 _EPALPLEPDS(ph)GGNTSPGVTANGEAR_
ARHGEF2 Phosphorylation T739 -0.489 _EPALPLEPDSGGNT(ph)SPGVTANGEAR_
ARHGEF2 Phosphorylation S740 -0.461 -0.375 _EPALPLEPDSGGNTS(ph)PGVTANGEAR_
ARHGEF2 Phosphorylation S930 -0.782 -1.060 _S(ph)LPAGDALYLSFNPPQPSR_
ARHGEF2 Phosphorylation S976 0.649 0.809 _QELGS(ph)PEER_
ASH1L Phosphorylation S1748 -0.660 -0.694 _SIDAVIATASAPPSSS(ph)PGR_
CCDC85C Phosphorylation S178 0.042 _S(ph)SIDSQASLSGPLSGGAPGAGAR_
CCDC85C Phosphorylation S179 0.042 _S(ph)SIDSQASLSGPLSGGAPGAGAR_
CCDC85C Ubiquitylation K285 0.218 _LLEGDK(gl)LLAQQAGSGEFR_
CCND1 Ubiquitylation K33 -0.490 _AMLK(gl)AEETCAPSVSYFK_
CCND1 Ubiquitylation K46 -1.016 -0.036 _AEETCAPSVSYFK(gl)CVQK_
CCND1 Ubiquitylation K95 -0.733 -0.137 _FLSLEPVK(gl)K_
CCND1 Ubiquitylation K96 -0.846 -0.155 _FLSLEPVKK(gl)_
CCND1 Ubiquitylation K238 0.245 _VIK(gl)CDPDCLR_
CDK4 Ubiquitylation K142 -0.552 _DLK(gl)PENILVTSGGTVK_
CDK4 Ubiquitylation K211 -0.101 _K(gl)PLFCGNSEADQLGK_
CDK4 Phosphorylation S236 0.095 _QDDS(ph)PSGASYGQDYDLS(ph)PSR_
CDK4 Phosphorylation S249 0.095 _QDDS(ph)PSGASYGQDYDLS(ph)PSR_
CDK4 Ubiquitylation K297 0.247 0.052 _ALQHSYLHK(gl)DEGNPE_
CDK4 Phosphorylation S385 0.649 _HSSIS(ph)PVRLPLNSSLGAELSR_
CDK4 Phosphorylation S420 0.004 -0.202 _ES(ph)KGSPVFLPR_
CDK4 Phosphorylation S423 -0.155 -0.297 _GS(ph)PVFLPR_
CDK4 Phosphorylation T514 0.364 0.570 _DSKPIALKEEIVT(ph)PK_
CDK4 Phosphorylation S681 -2.532 -2.051 _HLLTDLPLPPELPGGDLS(ph)PPDS(ph)PEPK_
CDK4 Phosphorylation S685 -2.729 _HLLTDLPLPPELPGGDLS(ph)PPDS(ph)PEPK_
CDK4 Phosphorylation T692 -0.765 -1.849 _AIT(ph)PPQQPYK_
CDK4 Phosphorylation S1082 -1.661 -0.980 _KETTSGTSTEPVKNS(ph)SPAPPQPAPGK_
CDK4 Phosphorylation S1083 -1.093 -1.330 _NSS(ph)PAPPQPAPGK_
CDK4 Phosphorylation T1244 -0.956 _RT(ph)PTMPQEEAAACPPHILPPEK_
CGN Phosphorylation S137 0.172 -0.057 _SHS(ph)QASLAGPGPVDPSNR_
CGN Phosphorylation S140 -0.337 _SHSQAS(ph)LAGPGPVDPSNR_
CGN Phosphorylation S155 0.173 0.694 _SNS(ph)MLELAPK_
CGN Phosphorylation S165 0.257 0.197 _VAS(ph)PGSTIDTAPLSSVDSLINK_
CGN Phosphorylation S168 -0.012 _VASPGS(ph)TIDTAPLSSVDSLINK_
CGN Ubiquitylation K356 0.623 0.473 _MQPLVMVSSGSTK(gl)AVAGQGELTR_
CGN Ubiquitylation K483 -0.071 _ELLEEVLEGK(gl)QR_
CGN Ubiquitylation K505 -0.299 -0.432 _GALK(gl)EEVASR_
CGN Ubiquitylation K965 -0.723 _QLK(gl)GLEEK_
CGNL1 Phosphorylation S283 0.693 0.384 _RQDS(ph)AGPVLDGAR_
CLDN1 Phosphorylation S206 -0.397 -0.443 _PAPSS(ph)GKDYV_
CLDN12 Phosphorylation S228 0.295 0.623 _S(ph)RLSAIEIDIPVVSHTT_
CXADR Phosphorylation S332 -0.817 -0.804 _TPQS(ph)PTLPPAK_
DLG1 Phosphorylation S102 -1.455 _SKPSEPIQPVNTWEISSLPSSTVTSETLPSSLS(ph)PSVEK_
DLG1 Phosphorylation T115 -0.707 -1.378 _YQDEDT(ph)PPQEHISPQITNEVIGPELVHVSEK_
DLG1 Phosphorylation S122 -1.073 _YQDEDTPPQEHIS(ph)PQITNEVIGPELVHVSEK_
DLG1 Phosphorylation S158 0.773 _NLSEIENVHGFVSHSHIS(ph)PIK_
DLG1 Ubiquitylation K321 1.264 1.435 _IMEIK(gl)LIK_
DLG1 Ubiquitylation K361 0.180 _IIEGGAAHK(gl)DGK_
DLG1 Ubiquitylation K452 -0.704 _YSPVSK(gl)AVLGDDEITREPR_
DLG1 Ubiquitylation K556 0.105 _FEAK(gl)IHDLR_
DLG1 Phosphorylation S573 0.697 _EQM(ox)M(ox)NSSISSGS(ph)GSLR_
DLG1 Phosphorylation S575 0.255 0.729 _EQMMNSSISSGSGS(ph)LR_
DLG1 Ubiquitylation K843 1.259 _SMENIMEMNK(gl)R_
DLG3 Phosphorylation S102 -1.455 _SKPSEPIQPVNTWEISSLPSSTVTSETLPSSLS(ph)PSVEK_
DLG3 Phosphorylation T115 -0.707 -1.378 _YQDEDT(ph)PPQEHISPQITNEVIGPELVHVSEK_
DLG3 Phosphorylation S122 -1.073 _YQDEDTPPQEHIS(ph)PQITNEVIGPELVHVSEK_
DLG3 Phosphorylation S158 0.773 _NLSEIENVHGFVSHSHIS(ph)PIK_
DLG3 Ubiquitylation K321 1.264 1.435 _IMEIK(gl)LIK_
DLG3 Ubiquitylation K361 0.180 _IIEGGAAHK(gl)DGK_
DLG3 Ubiquitylation K368 1.043 1.755 _IIEGGAAQK(gl)DGR_
DLG3 Ubiquitylation K452 -0.704 _YSPVSK(gl)AVLGDDEITREPR_
DLG3 Ubiquitylation K556 0.105 _FEAK(gl)IHDLR_
DLG3 Phosphorylation S573 0.697 _EQM(ox)M(ox)NSSISSGS(ph)GSLR_
DLG3 Phosphorylation S575 0.255 0.729 _EQMMNSSISSGSGS(ph)LR_
DLG3 Ubiquitylation K843 1.259 _SMENIMEMNK(gl)R_
EPCAM Ubiquitylation K196 0.705 _TALQK(gl)EITTR_
EPCAM Ubiquitylation K327 -0.248 -0.026 _YEK(gl)AEIK_
EPCAM Ubiquitylation K331 0.746 0.567 _AEIK(gl)EMGEM(ox)HR_
F11R Phosphorylation S288 0.335 0.373 _VIYSQPS(ph)AR_
F11R Ubiquitylation K296 0.445 0.876 _SEGEFK(gl)QTSSFLV_
INADL Phosphorylation T335 0.065 -0.131 _DPAGDISVT(ph)PPAPAALPVALPTVASK_
INADL Phosphorylation T1209 0.020 _ALT(ph)DDSDENEEEDAFTDQK_
INADL Phosphorylation S1212 0.792 0.370 _ALTDDS(ph)DENEEEDAFTDQK_
JAM2 Ubiquitylation K291 0.436 0.826 _ATTMSENDFK(gl)HTK_
LIN7A Ubiquitylation K91 0.346 _ATAK(gl)ATVAAFAASEGHSHPR_
LIN7C Ubiquitylation K76 0.092 _ANATAK(gl)ATVAAFAASEGHSHPR_
LIN7C Ubiquitylation K161 0.279 0.161 _AVELLK(gl)AAQGK_
LIN7C Ubiquitylation K176 -0.064 0.362 _YTPK(gl)VLEEMESR_
MAGI3 Phosphorylation S722 -0.403 _S(ph)GSPKLDPSEVYLK_
MAGI3 Phosphorylation S724 -0.403 _SGS(ph)PKLDPSEVYLK_
MARVELD3 Ubiquitylation K109 0.820 _AGEHGVWEK(gl)PR_
MPDZ Phosphorylation S230 -0.025 0.367 _GSLPQLVS(ph)PIVSR_
MPDZ Phosphorylation S352 -0.544 -0.047 _TAPTALGITLS(ph)SSPTSTPELR_
MPDZ Phosphorylation S354 -0.160 -0.102 _TAPTALGITLSSS(ph)PTSTPELR_
MPDZ Phosphorylation S483 1.136 1.210 _DADLS(ph)PVNASIIK_
MPDZ Phosphorylation S1609 0.051 -0.593 _KNSSQSLM(ox)VPQSGS(ph)PEPESIR_
MPDZ Ubiquitylation K1701 0.095 _K(gl)ATHDEAINVLR_
MPDZ Ubiquitylation K2036 -0.005 _TVFAK(gl)GAASEDGR_
MTDH Phosphorylation T143 -0.168 _TVEVAEGEAVRT(ph)PQSVTAK_
MTDH Phosphorylation S298 3.215 2.229 _LSSQIS(ph)AGEEK_
MTDH Phosphorylation S308 -1.181 -0.077 _WNSVS(ph)PASAGK_
MTDH Phosphorylation S426 0.024 0.054 _SQEPIPDDQKVS(ph)DDDKEK_
MTDH Ubiquitylation K504 -0.009 _TISTSDPAEVLVK(gl)NSQPIK_
MTDH Phosphorylation S568 -1.097 -0.503 _SETSWES(ph)PK_
NHS Phosphorylation T997 -0.586 -0.326 _AT(ph)TPSLPSVDNEFK_
NHS Phosphorylation T998 -0.362 -0.318 _ATT(ph)PSLPSVDNEFK_
OCLN Ubiquitylation K330 -0.208 -0.513 _VDSPMAYSSNGK(gl)VNDKR_
OCLN Phosphorylation S341 -0.395 -0.095 _RFYPESS(ph)YK_
OCLN Phosphorylation T357 0.065 0.472 _STPVPEVVQELPLT(ph)SPVDDFR_
OCLN Phosphorylation S358 0.095 0.535 _STPVPEVVQELPLTS(ph)PVDDFR_
OCLN Phosphorylation S370 0.069 0.114 _YSS(ph)GGNFETPSK_
OCLN Phosphorylation T376 -1.372 -1.062 _YSSGGNFET(ph)PSK_
OCLN Ubiquitylation K379 -0.036 0.238 _YSSGGNFETPSK(gl)R_
OCLN Phosphorylation S408 1.405 _RTEQDHYETDYTTGGES(ph)CDELEEDWIR_
OCLN Ubiquitylation K488 0.113 _LKQVK(gl)GSADYK_
PARD3 Phosphorylation S143 -0.152 0.186 _RS(ph)SDPALIGLSTSVSDSNFSSEEPSR_
PARD3 Phosphorylation S144 0.099 -0.057 _RS(ph)SDPALIGLSTSVSDSNFSSEEPSR_
PARD3 Phosphorylation S383 0.377 0.343 _FS(ph)PDSQYIDNR_
PARD3 Phosphorylation T579 2.050 2.128 _AEDEDIVLT(ph)PDGTR_
PARD3 Phosphorylation S692 -0.647 -0.931 _S(ph)PGSPPGPELPIETALDDRER_
PARD3 Phosphorylation S695 -0.895 -1.092 _SPGS(ph)PPGPELPIETALDDRER_
PARD3 Phosphorylation S715 1.428 -0.219 _RIS(ph)HSLYSGIEGLDESPSR_
PARD3 Phosphorylation S728 -0.196 0.339 _ISHSLYSGIEGLDES(ph)PSR_
PARD3 Phosphorylation S795 0.353 -0.344 _S(ph)M(ox)DLVADETK_
PARD3 Phosphorylation S809 2.141 1.530 _AAISDSADCSLS(ph)PDVDPVLAFQR_
PARD3 Phosphorylation S850 1.009 1.041 _S(ph)KSMDLGIADETK_
PARD3 Phosphorylation S852 0.640 0.638 _S(ph)MDLGIADETK_
PARD3 Ubiquitylation K886 -0.879 _DVGPSLGLKK(gl)_
PARD3 Phosphorylation S973 -0.243 -0.400 _ESVSTASDQPSHS(ph)LER_
PARD3 Phosphorylation S1178 -0.282 -0.511 _TYS(ph)FEQPWPNAR_
PARD3B Phosphorylation S730 0.898 _SES(ph)PSKDFGPTLGLK_
PARD3B Phosphorylation S746 0.920 _SSS(ph)LESLQTAVAEVR_
PARD6B Phosphorylation S11 0.746 0.842 _HGAGS(ph)GCLGTM(ox)EVK_
PRKCZ Phosphorylation T560 -0.884 -1.578 _KQALPPFQPQITDDYGLDNFDTQFTSEPVQLT(ph)PDDEDAIKR_
RAB10 Ubiquitylation K163 0.199 _LLLGNK(gl)CDMEAK_
RAB10 Ubiquitylation K174 -0.188 _VQK(gl)EQADKLAR_
RAB10 Ubiquitylation K213 -0.059 0.420 _DILLK(gl)SGGR_
SHROOM2 Phosphorylation S1337 -0.977 -0.027 _SLADILDPS(ph)VKIK_
STRN Phosphorylation S369 -0.881 _DVDELPS(ph)LQPSVGSPSRPSSSR_
STRN Phosphorylation S376 -2.092 -2.120 _DVDELPSLQPSVGS(ph)PSRPSSSR_
SYMPK Ubiquitylation K490 -0.556 -1.231 _TESVLIK(gl)R_
SYMPK Phosphorylation S494 0.456 -0.279 _RLS(ph)AQGQAISVVGSLSSMSPLEEEAPQAK_
SYMPK Phosphorylation S501 0.517 -0.005 _RLSAQGQAIS(ph)VVGSLSSMSPLEEEAPQAK_
SYMPK Ubiquitylation K551 -0.114 _LSDVLK(gl)PLTDAQVEAMK_
SYMPK Ubiquitylation K1040 0.447 0.966 _VWEGFIK(gl)CCQR_
SYMPK Phosphorylation S1170 -0.325 _LKPGGVGAPSSS(ph)SPSPSPSAR_
SYMPK Phosphorylation S1171 -0.647 -0.147 _LKPGGVGAPSSSS(ph)PSPSPSAR_
SYMPK Phosphorylation S1173 1.053 -2.091 _LKPGGVGAPSSSSPS(ph)PSPSAR_
SYMPK Phosphorylation T1231 0.104 -0.160 _ET(ph)AAGGLTLKEERSPQTLAPVGEDAMK_
SYMPK Phosphorylation T1237 0.076 _ETAAGGLT(ph)LKEERSPQTLAPVGEDAM(ox)K_
SYMPK Phosphorylation S1243 0.014 -0.294 _S(ph)PQTLAPVGEDAM(ox)K_
SYMPK Phosphorylation S1259 -0.172 -1.286 _TPS(ph)PAAEDAREPEAK_
TBCD Ubiquitylation K221 -0.672 -1.403 _FITRPDVK(gl)QSK_
TBCD Ubiquitylation K299 -0.144 _LGVK(gl)LVQR_
TBCD Ubiquitylation K310 -0.882 _LGLTFLK(gl)PK_
TBCD Ubiquitylation K453 0.010 -0.719 _ALTYDEK(gl)R_
TBCD Ubiquitylation K691 -1.291 _LSLSK(gl)MPFR_
TBCD Ubiquitylation K820 -0.089 -0.799 _DGLK(gl)AIAR_
TBCD Ubiquitylation K913 0.550 _IMCCVAQQASEK(gl)IDR_
TBCD Ubiquitylation K1076 -0.225 _LLALCK(gl)K_
TBCD Ubiquitylation K1077 -0.225 _LLALCK(gl)K_
TGFBR1 Ubiquitylation K449 -0.991 _VVCEQK(gl)LRPNIPNR_
TGFBR1 Ubiquitylation K502 0.553 0.430 _TLSQLSQQEGIK(gl)M_
TJAP1 Phosphorylation S300 -0.036 -0.097 _GS(ph)PEEELPLPAFEK_
TJAP1 Phosphorylation T422 -0.076 _AFVDRT(ph)PPPAAVAQR_
TJAP1 Phosphorylation S491 0.784 _EEEELNLPIS(ph)PEEER_
TJAP1 Phosphorylation S545 0.475 0.535 _KDS(ph)LTQAQEQGNLLN_
TJP1 Ubiquitylation K54 0.081 -0.398 _GSLLPLK(gl)R_
TJP1 Ubiquitylation K157 0.023 -0.755 _SEK(gl)IWPR_
TJP1 Phosphorylation S175 0.113 -0.041 _S(ph)VASSQPAKPTK_
TJP1 Ubiquitylation K187 -0.394 _SVASSQPAK(gl)PTK_
TJP1 Ubiquitylation K198 0.760 0.143 _SRK(gl)NEEYGLR_
TJP1 Phosphorylation S329 -0.569 -0.354 _HS(ph)PQQPSNGSLR_
TJP1 Phosphorylation S353 -0.522 -0.375 _ISKPGAVS(ph)TPVK_
TJP1 Phosphorylation S617 0.438 0.543 _S(ph)REDLSAQPVQTK_
TJP1 Ubiquitylation K677 -0.484 _EEPDIYQIAK(gl)SEPR_
TJP1 Phosphorylation S912 -0.113 _IDS(ph)PGFKPASQQK_
TJP1 Phosphorylation S916 -0.049 0.102 _IDS(ph)PGFKPASQQVYR_
TJP1 Ubiquitylation K920 7.379 6.153 _IDSPGFK(gl)PASQQVYR_
TJP1 Phosphorylation S968 -0.778 _LEEPTPAPSTSYS(ph)PQADSLR_
TJP1 Phosphorylation S1579 0.045 -0.197 _SHS(ph)LAQPPEFDSGVETFSIHAEKPK_
TJP1 Phosphorylation S1617 0.665 _AIPVS(ph)PSAVEEDEDEDGHTVVATAR_
TJP2 Phosphorylation S161 -0.169 -0.024 _VQVAALQAS(ph)PPLDQDDR_
TJP2 Phosphorylation S205 0.118 0.563 _SWEDS(ph)PER_
TJP2 Phosphorylation S275 0.891 0.690 _GRS(ph)IDQDYER_
TJP2 Phosphorylation S297 0.478 0.579 _AYS(ph)PEYR_
TJP2 Phosphorylation S446 0.631 _SFS(ph)PEER_
TJP2 Phosphorylation S471 -0.863 0.159 _ERPS(ph)SREDTPSR_
TJP2 Phosphorylation S472 -0.715 0.193 _ERPSS(ph)REDTPSR_
TJP2 Ubiquitylation K506 -0.355 -0.981 _STGDIAGTVVPETNK(gl)EPR_
TJP2 Ubiquitylation K520 -1.549 _YQEEPPAPQPK(gl)AAPR_
TJP2 Ubiquitylation K800 -0.173 0.403 _DAGSEK(gl)STGVVR_
TJP2 Phosphorylation S992 -0.733 _SSEPVQHEES(ph)IRKPSPEPR_
TJP2 Phosphorylation S997 -1.075 -0.616 _SSEPVQHEESIRKPS(ph)PEPR_
TJP2 Phosphorylation S1017 -1.379 -1.918 _DNS(ph)PPPAFKPEPPK_
TJP2 Ubiquitylation K1047 -0.374 -0.833 _SYEYK(gl)SNPSAVAGNETPGASTK_
TJP2 Phosphorylation S1187 0.856 _GS(ph)YGSDAEEEEYRQQLSEHSK_
TJP2 Phosphorylation S1190 0.754 0.727 _GSYGS(ph)DAEEEEYRQQLSEHSK_
TRAF4 Phosphorylation S426 0.249 _GS(ph)LDESSLGFGYPK_
UBN1 Phosphorylation S660 -0.661 _ELPSQASGGLANPPPVNLEDS(ph)LDEDLIRNPASSVEAVSK_
VAPA Ubiquitylation K180 1.211 _LMEECK(gl)R_
VAPA Ubiquitylation K188 0.176 0.874 _LQGEMMK(gl)LSEENR_
VAPA Phosphorylation S214 0.747 1.178 _VAHSDKPGS(ph)TSTASFR_
VASP Phosphorylation S239 0.625 -0.774 _VS(ph)KQEEASGGPTAPK_
YBX2 Phosphorylation S34 -1.234 -1.488 _S(ph)PVGSGAPQAAAPAPAAHVAGNPGGDAAPAATGTAAAASLATAAGSEDAEK_
YBX2 Phosphorylation S79 -2.262 _SPVGSGAPQAAAPAPAAHVAGNPGGDAAPAATGTAAAASLATAAGS(ph)EDAEKK_
YBX2 Ubiquitylation K90 3.724 2.851 _VLATK(gl)VLGTVK_
YBX2 Ubiquitylation K96 5.830 4.056 _VLGTVK(gl)WFNVR_
YBX2 Ubiquitylation K113 1.472 1.136 _NDTK(gl)EDVFVHQTAIK_
YBX2 Ubiquitylation K124 -0.184 0.337 _NDTKEDVFVHQTAIK(gl)K(gl)NNPR_
YBX2 Ubiquitylation K125 -0.123 0.220 _NDTKEDVFVHQTAIK(gl)K(gl)NNPR_
YBX2 Phosphorylation S203 -0.609 -0.604 _NYAGEEEEEGSGS(ph)SEGFDPPATDR_
YBX2 Ubiquitylation K268 -0.103 -0.702 _IQAGEIGEMK(gl)DGVPEGAQLQGPVHR_
YBX2 Phosphorylation S324 -1.327 -0.720 _PAPAVGEAEDKENQQATSGPNQPS(ph)VR_


© Copyright Svejstrup Laboratory 2015