bioLOGIC Data » bioLOGIC CategoryView » bioLOGIC VennView » Experimental Details »
bioLOGIC Category

Results for the Category
phosphoprotein phosphatase activity
(GO:0004721)

RNAi screen result RNAPII IP (MG132) CSB IP CSB IP (MG132) Chrom. Chrom. (MG132) Ubi /Phospo Ubi /Phospho (MG132)
W

Protein Results:

Results for post-translational modifications (below)
Gene name MGoogle Score RNAi high RNAi low RNAPII-IP (MG132) CSB-IP CSB-IP (MG132) Chrom. Chrom. (MG132)
PPP1CA 3 2.150 -0.860
PPP1CA 3 2.150 -0.860 -0.250 0.634 0.981 -0.108 0.171
PPM1G 2 -0.190 -0.120 -0.705 0.316 0.971 1.049
PPP1CC 2 0.390 -0.090
PPP1CC 2 0.390 -0.090 0.568 0.526 0.917 -0.533 0.173
DLG1 1 0.400 -0.220 1.552 0.102 0.488
PPP2CB 1 2.210 -0.980 0.194 0.044 0.215
PPP2CB 1 2.210 -0.980 0.650 1.189
DLGAP5 1 -2.380 4.820 -0.852
DUSP9 1 -2.590 5.800
PPP5C 0 -0.140 -0.230 0.937
PPP5C 0 -0.140 -0.230
PHPT1 0 1.160 -0.880
SSH1 0 -0.780 1.560
CDKN3 0 0.480 -0.130
PPM1A 0 -0.680 1.340 0.402
PPM1A 0 -0.680 1.340 -1.556 -0.874
TIMM50 0 0.710 -0.640 0.428 -0.608 -0.459 -1.171 -0.634
PPP3CB 0 -1.240 2.140 -0.298 1.130
PPP3CB 0 -1.240 2.140 0.923 0.537
DUSP3 0 0.360 -0.500
PPM1H 0 -0.220 0.030
PPP2CA 0 0.160 -0.540 0.194 0.044 0.215
PPP2CA 0 0.160 -0.540 0.650 1.189
PPP6C 0 0.340 -0.620 0.715 -0.944 -0.116 0.577
PPP3CC 0 -0.380 1.050 -0.298 1.130
PPP3CC 0 -0.380 1.050 0.923 0.537
PTPN12 0 -0.330 -0.270
DUSP6 0 0.100 0.300
DUSP7 0 -0.270 0.070
CTDSPL2 0 -0.090 0.960 0.296 0.372
PPM1B 0 -0.180 0.420 -0.429 0.307
PPM1B 0 -0.180 0.420 0.248
PPP3CA 0 1.550 -1.230 -0.298 1.130
PPP3CA 0 1.550 -1.230 0.923 0.537
SSH2 0 -0.270 0.300
CTDSPL 0 0.540 -0.790
PPP4C 0 -0.050 0.050 0.322
PPP4R1 0 0.530 -0.450
PPEF2 0
SSU72 0 1.030 -0.450
PPAP2B 0 -0.750 0.840
UBLCP1 0 0.350 -0.640
PTPN11 0 -0.210 -0.400 0.644 1.053 0.451
PPTC7 0 0.140 -0.520
PDXP 0 0.680 -0.250 -2.986
PGAM5 0 -0.280 0.420 -1.333 0.162 -0.092

PTM Sites:

Back to Protein Results
Gene name PTM type PTM site UV UV (MG132) Sequence
CDKN3 Ubiquitylation K86 -0.893 0.100 _GELSK(gl)YR_
CTDSPL Ubiquitylation K190 -0.115 _GNYVK(gl)DLSR_
CTDSPL2 Phosphorylation T86 -0.976 -0.825 _DIDNNLITST(ph)PR_
CTDSPL2 Ubiquitylation K95 -0.319 _AGEKPNK(gl)QISR_
DLG1 Phosphorylation S102 -1.455 _SKPSEPIQPVNTWEISSLPSSTVTSETLPSSLS(ph)PSVEK_
DLG1 Phosphorylation T115 -0.707 -1.378 _YQDEDT(ph)PPQEHISPQITNEVIGPELVHVSEK_
DLG1 Phosphorylation S122 -1.073 _YQDEDTPPQEHIS(ph)PQITNEVIGPELVHVSEK_
DLG1 Phosphorylation S158 0.773 _NLSEIENVHGFVSHSHIS(ph)PIK_
DLG1 Ubiquitylation K321 1.264 1.435 _IMEIK(gl)LIK_
DLG1 Ubiquitylation K361 0.180 _IIEGGAAHK(gl)DGK_
DLG1 Ubiquitylation K452 -0.704 _YSPVSK(gl)AVLGDDEITREPR_
DLG1 Ubiquitylation K556 0.105 _FEAK(gl)IHDLR_
DLG1 Phosphorylation S573 0.697 _EQM(ox)M(ox)NSSISSGS(ph)GSLR_
DLG1 Phosphorylation S575 0.255 0.729 _EQMMNSSISSGSGS(ph)LR_
DLG1 Ubiquitylation K843 1.259 _SMENIMEMNK(gl)R_
DLGAP5 Phosphorylation T661 -0.604 _NEMGIPQQTT(ph)SPENAGPQNTK_
DLGAP5 Phosphorylation S662 -1.032 -0.577 _NEMGIPQQTTS(ph)PENAGPQNTK_
DLGAP5 Phosphorylation S689 -0.077 -0.102 _S(ph)SIEDAQCPGLPDLIEENHVVNK_
DLGAP5 Phosphorylation S690 -0.077 -0.395 _S(ph)SIEDAQCPGLPDLIEENHVVNK_
DLGAP5 Phosphorylation S774 1.237 _NTAS(ph)QNSILEEGETK_
DLGAP5 Phosphorylation S806 0.216 _SLTTECHLLDS(ph)PGLNCSNPFTQLER_
DUSP3 Ubiquitylation K116 -0.586 _AADFIDQALAQK(gl)NGR_
DUSP6 Phosphorylation S328 0.484 0.292 _SNIS(ph)PNFNFMGQLLDFER_
DUSP7 Phosphorylation S328 0.484 0.292 _SNIS(ph)PNFNFMGQLLDFER_
DUSP9 Phosphorylation S328 0.484 0.292 _SNIS(ph)PNFNFMGQLLDFER_
PGAM5 Ubiquitylation K88 -0.544 0.311 _NVESGEEELASK(gl)LDHYK_
PGAM5 Ubiquitylation K141 -0.419 0.750 _LASLGLK(gl)FNK_
PHPT1 Ubiquitylation K41 -0.457 _SGAPAAESK(gl)EIVR_
PHPT1 Ubiquitylation K59 0.288 0.409 _WAEYHADIYDK(gl)VSGDMQK_
PPAP2B Ubiquitylation K5 0.619 0.462 _(ac)MQNYK(gl)YDK_
PPAP2B Ubiquitylation K8 0.265 0.647 _YDK(gl)AIVPESK_
PPAP2B Ubiquitylation K15 -0.741 -0.668 _AIVPESK(gl)NGGSPALNNNPR_
PPEF2 Phosphorylation Y466 1.425 _GGGCY(ph)FGPDVTQQLLQKYNMQFLIRS(ph)HECK_
PPEF2 Phosphorylation S487 1.425 _GGGCY(ph)FGPDVTQQLLQKYNMQFLIRS(ph)HECK_
PPM1A Ubiquitylation K278 -0.176 _VCNEVVDTCLYK(gl)GSR_
PPM1B Ubiquitylation K90 -0.117 _AAGK(gl)SGSALELSVENVK_
PPM1G Phosphorylation S183 2.866 2.103 _SGGGTGEEPGS(ph)QGLNGEAGPEDSTR_
PPM1G Ubiquitylation K209 -1.051 -0.856 _ETPSQENGPTAK(gl)AYTGFSSNSER_
PPM1G Ubiquitylation K247 -2.531 _GTEAGQVGEPGIPTGEAGPSCSSASDK(gl)LPR_
PPM1G Ubiquitylation K339 -0.202 0.936 _GK(gl)QLIVANAGDSR_
PPM1G Ubiquitylation K383 0.075 0.659 _NAGGK(gl)VTMDGR_
PPM1G Ubiquitylation K519 -0.336 -0.692 _NTAELQPESGK(gl)R_
PPM1H Phosphorylation S123 0.026 _RS(ph)SLPNGEGLQLK_
PPP1CA Ubiquitylation K6 0.594 0.414 _(ac)SDSEK(gl)LNLDSIIGR_
PPP1CA Ubiquitylation K50 -0.131 0.478 _GLCLK(gl)SR_
PPP1CA Ubiquitylation K150 0.321 0.619 _IYGFYDECK(gl)RR_
PPP1CA Ubiquitylation K156 0.883 1.047 _YNIK(gl)LWK_
PPP1CA Ubiquitylation K247 0.313 _FLHK(gl)HDLDLICR_
PPP1CA Ubiquitylation K269 2.628 2.591 _AHQVVEDGYEFFAK(gl)R_
PPP1CC Ubiquitylation K35 -0.280 -0.504 _GSKPGK(gl)NVQLQENEIR_
PPP1CC Ubiquitylation K50 -0.131 0.478 _GLCLK(gl)SR_
PPP1CC Ubiquitylation K150 0.321 0.619 _IYGFYDECK(gl)RR_
PPP1CC Ubiquitylation K156 0.883 1.047 _YNIK(gl)LWK_
PPP1CC Ubiquitylation K247 0.313 _FLHK(gl)HDLDLICR_
PPP1CC Ubiquitylation K269 2.628 2.591 _AHQVVEDGYEFFAK(gl)R_
PPP1CC Phosphorylation T320 -0.561 _KPNATRPVT(ph)PPR_
PPP1CC Ubiquitylation K328 0.848 0.425 _GMITK(gl)QAK_
PPP2CA Ubiquitylation K4 -0.788 -0.378 _(ac)MDDK(gl)AFTK_
PPP2CA Ubiquitylation K4 -0.450 -0.016 _(ac)M(ox)DEK(gl)VFTK_
PPP2CA Ubiquitylation K8 -0.522 _VFTK(gl)ELDQWIEQLNECK_
PPP2CA Ubiquitylation K21 -1.370 _ELDQWVEQLNECK(gl)QLNENQVR_
PPP2CA Ubiquitylation K21 -1.106 _ELDQWIEQLNECK(gl)QLSESQVK_
PPP2CA Ubiquitylation K29 0.211 0.122 _QLSESQVK(gl)SLCEK_
PPP2CA Ubiquitylation K36 -0.455 0.187 _AK(gl)EILTK_
PPP2CA Ubiquitylation K36 -0.455 0.187 _AK(gl)EILTK_
PPP2CA Ubiquitylation K41 -0.049 0.003 _EILTK(gl)ESNVQEVR_
PPP2CA Ubiquitylation K74 -0.316 -0.316 _IGGK(gl)SPDTNYLFMGDYVDR_
PPP2CB Ubiquitylation K4 -0.788 -0.378 _(ac)MDDK(gl)AFTK_
PPP2CB Ubiquitylation K4 -0.450 -0.016 _(ac)M(ox)DEK(gl)VFTK_
PPP2CB Ubiquitylation K8 -0.522 _VFTK(gl)ELDQWIEQLNECK_
PPP2CB Ubiquitylation K21 -1.370 _ELDQWVEQLNECK(gl)QLNENQVR_
PPP2CB Ubiquitylation K21 -1.106 _ELDQWIEQLNECK(gl)QLSESQVK_
PPP2CB Ubiquitylation K29 0.211 0.122 _QLSESQVK(gl)SLCEK_
PPP2CB Ubiquitylation K36 -0.455 0.187 _AK(gl)EILTK_
PPP2CB Ubiquitylation K36 -0.455 0.187 _AK(gl)EILTK_
PPP2CB Ubiquitylation K41 -0.049 0.003 _EILTK(gl)ESNVQEVR_
PPP2CB Ubiquitylation K74 -0.316 -0.316 _IGGK(gl)SPDTNYLFMGDYVDR_
PPP3CA Ubiquitylation K32 -0.137 _LTAK(gl)EVFDNDGKPR_
PPP3CA Ubiquitylation K56 0.132 _VDVLK(gl)NHLVK_
PPP3CA Ubiquitylation K323 0.705 _AAVLK(gl)YENNVMNIR_
PPP3CA Ubiquitylation K405 0.078 _AIGK(gl)MAR_
PPP3CB Ubiquitylation K32 -0.137 _LTAK(gl)EVFDNDGKPR_
PPP3CB Ubiquitylation K56 0.132 _VDVLK(gl)NHLVK_
PPP3CB Ubiquitylation K323 0.705 _AAVLK(gl)YENNVMNIR_
PPP3CB Ubiquitylation K405 0.078 _AIGK(gl)MAR_
PPP3CC Ubiquitylation K32 -0.137 _LTAK(gl)EVFDNDGKPR_
PPP3CC Ubiquitylation K56 0.132 _VDVLK(gl)NHLVK_
PPP3CC Ubiquitylation K323 0.705 _AAVLK(gl)YENNVMNIR_
PPP3CC Ubiquitylation K405 0.078 _AIGK(gl)MAR_
PPP4C Ubiquitylation K26 -0.494 -0.192 _ESEVK(gl)ALCAK(gl)AR_
PPP4C Ubiquitylation K31 -0.607 0.349 _ESEVK(gl)ALCAK(gl)AR_
PPP4C Ubiquitylation K133 -0.603 _K(gl)YGSVTVWR_
PPP4R1 Ubiquitylation K887 0.143 _VLLAK(gl)TLR_
PPP5C Ubiquitylation K42 -0.703 _AK(gl)DYENAIK_
PPP6C Ubiquitylation K25 -0.474 _YLPENDLK(gl)R_
PPTC7 Ubiquitylation K242 -0.914 _LK(gl)NSNYESIQQTAR_
PTPN11 Ubiquitylation K124 0.562 _EAEK(gl)LLTEK_
PTPN12 Phosphorylation S571 -1.186 -0.973 _TVSLTPS(ph)PTTQVETPDLVDHDNTSPLFR_
PTPN12 Phosphorylation S588 -1.129 -1.279 _TVSLTPSPTTQVETPDLVDHDNTS(ph)PLFR_
PTPN12 Phosphorylation S673 -0.767 -0.786 _DVDVSEDS(ph)PPPLPER_
SSH1 Phosphorylation S937 0.799 0.728 _SSS(ph)SDSIHSVR_
SSH2 Phosphorylation S514 0.350 0.184 _DITTS(ph)ADQIAEVK_
SSU72 Ubiquitylation K28 -0.190 0.633 _SMEAHNILSK(gl)R_
TIMM50 Ubiquitylation K167 -0.380 _AQGPQQQPGSEGPSYAK(gl)K_
TIMM50 Ubiquitylation K168 -0.380 _AQGPQQQPGSEGPSYAK(gl)K_
TIMM50 Ubiquitylation K353 -0.109 _VVVVDCK(gl)K_
TIMM50 Ubiquitylation K354 -0.109 _VVVVDCK(gl)K_
TIMM50 Ubiquitylation K434 0.302 _LAELSK(gl)SNK_
TIMM50 Ubiquitylation K437 0.101 -0.071 _SNK(gl)QNLFLGSLTSR_
UBLCP1 Ubiquitylation K65 -0.075 _LGALK(gl)LKPNTK_
UBLCP1 Ubiquitylation K246 -0.551 -0.248 _FSEFYSKK(gl)_


© Copyright Svejstrup Laboratory 2015