bioLOGIC Data » bioLOGIC CategoryView » bioLOGIC VennView » Experimental Details »
bioLOGIC Category

Results for the Category
PID_TCPTP_PATHWAY
(Pathway_593)

RNAi screen result RNAPII IP (MG132) CSB IP CSB IP (MG132) Chrom. Chrom. (MG132) Ubi /Phospo Ubi /Phospho (MG132)
W

Protein Results:

Results for post-translational modifications (below)
Gene name MGoogle Score RNAi high RNAi low RNAPII-IP (MG132) CSB-IP CSB-IP (MG132) Chrom. Chrom. (MG132)
INSR 2 -0.850 0.830 1.143 0.785
PIK3R2 1 2.740 -1.180 0.269 0.348
EIF2A 1 -0.180 -0.460 -0.199 -1.243 -0.618
STAT6 1 2.310 -1.150 -0.421 -0.069
ATR 1 -1.040 0.920 0.671 1.041 0.708
CREBBP 0 0.840 -0.950 -3.889 -1.071
PIAS1 0 -1.020 1.720 -1.034 -0.678 0.471 -0.051 1.019
PIK3CB 0 -1.390 2.350
PIK3CB 0 -0.710 1.450
EIF2AK2 0 -1.060 1.180 -0.657 -0.502 0.213 -0.027
LMAN1 0 0.562 0.393
LMAN1 0
MET 0 -0.010 -0.330
KPNB1 0 -1.100 2.030 0.513 -0.057 0.327 0.627 0.452
GAB1 0 1.950 -1.110
STAT1 0 -0.550 0.170
SOS1 0 0.500 -0.620 -0.570
PIK3R3 0 -0.140 -0.480
PIK3R3 0 -0.140 -0.480 -0.441 0.147
PIK3CA 0
KDR 0 0.860 -0.680
PIK3R1 0 1.910 -1.220 -0.441 0.147
EGFR 0 -0.580 0.520 0.513 0.090
ITGB1 0 0.390 -0.650 0.101 -0.036
JAK1 0 0.190 -0.100 -1.504 -0.381 -0.438
STAT3 0 0.200 -1.270 0.334
STAT5B 0 0.670 -0.960
PTPN2 0 1.210 -0.730
GRB2 0 -0.240 0.300 -1.021 0.057 0.906
PTPN1 0 -0.150 0.310 1.066 0.459 0.251 0.322 0.379
SRC 0 0.050 0.470 -0.031
ITGA1 0 -0.750 1.480 0.650 0.069

PTM Sites:

Back to Protein Results
Gene name PTM type PTM site UV UV (MG132) Sequence
ATR Ubiquitylation K32 -0.929 _ELGSATPEEYNTVVQK(gl)PR_
ATR Phosphorylation S435 0.516 0.284 _RLS(ph)SSLNPSK_
ATR Ubiquitylation K746 -1.823 _NLK(gl)ATSQHECSSSQLK_
ATR Ubiquitylation K1019 1.662 _TLGK(gl)QLNVNRR_
ATR Ubiquitylation K1600 -0.437 _FQALK(gl)AEK_
ATR Ubiquitylation K2106 -0.136 _AYEWEK(gl)AGR_
ATR Ubiquitylation K2604 0.657 1.118 _LQGVIK(gl)TR_
CREBBP Phosphorylation S2093 0.037 0.097 _SIS(ph)PSALQDLLR_
EGFR Phosphorylation T693 0.486 -0.139 _ELVEPLT(ph)PSGEAPNQALLR_
EGFR Phosphorylation S991 -0.041 _MHLPS(ph)PTDSNFYR_
EIF2A Ubiquitylation K40 7.150 _NCK(gl)VCIFSK_
EIF2A Phosphorylation S503 -0.843 -0.645 _S(ph)DKSPDLAPTPAPQSTPR_
EIF2A Phosphorylation S506 -0.882 -0.939 _SDKS(ph)PDLAPTPAPQSTPR_
EIF2AK2 Phosphorylation S83 0.256 _KAVS(ph)PLLLTTTNSSEGLSMGNYIGLINR_
GAB1 Phosphorylation S266 0.756 0.551 _SYS(ph)HDVLPK_
GAB1 Phosphorylation S367 0.230 0.176 _TAS(ph)DTDSSYCIPTAGMS(ph)PSR_
GAB1 Phosphorylation T369 -0.352 _TASDT(ph)DSSYCIPTAGMS(ph)PSR_
GAB1 Phosphorylation S381 -0.481 0.139 _TASDTDSSYCIPTAGM(ox)S(ph)PSR_
GAB1 Phosphorylation S401 0.266 0.788 _DAS(ph)SQDCYDIPR_
GAB1 Phosphorylation S402 0.328 0.633 _DASS(ph)QDCYDIPR_
GAB1 Phosphorylation S419 0.540 _SSS(ph)LEGFHNHFK_
GRB2 Ubiquitylation K10 0.146 _YDFK(gl)ATADDELSFK_
GRB2 Ubiquitylation K20 -0.078 _ATADDELSFK(gl)R_
GRB2 Ubiquitylation K69 -0.362 0.641 _AK(gl)AEEMLSK_
GRB2 Ubiquitylation K76 0.754 _AEEMLSK(gl)QR_
GRB2 Ubiquitylation K109 0.381 -0.002 _FGNDVQHFK(gl)VLR_
INSR Ubiquitylation K1022 -0.603 _EK(gl)ITLLR_
INSR Ubiquitylation K1047 0.305 0.711 _DIIK(gl)GEAETR_
INSR Ubiquitylation K1057 0.482 0.484 _VAVK(gl)TVNESASLR_
INSR Ubiquitylation K1352 1.606 2.754 _DGGSSLGFK(gl)R_
ITGB1 Ubiquitylation K774 0.402 _MNAK(gl)WDTGENPIYK_
ITGB1 Ubiquitylation K784 -0.172 0.350 _WDTGENPIYK(gl)SAVTTVVNPK_
ITGB1 Ubiquitylation K794 0.755 0.604 _SAVTTVVNPK(gl)YEGK_
JAK1 Ubiquitylation K227 -0.405 _YIPETLNK(gl)SIR_
JAK1 Ubiquitylation K249 0.116 0.771 _DFLK(gl)EFNNK_
JAK1 Ubiquitylation K559 -0.478 _EISNLLVATK(gl)K_
KDR Ubiquitylation K1064 -1.119 _DIYK(gl)DPDYVR_
KPNB1 Ubiquitylation K68 0.403 0.420 _NSLTSK(gl)DPDIK_
KPNB1 Ubiquitylation K73 -0.134 _NSLTSKDPDIK(gl)AQYQQR_
KPNB1 Ubiquitylation K211 -0.036 _ANFDK(gl)ESER_
KPNB1 Ubiquitylation K549 -0.563 _DCYPAVQK(gl)TTLVIMER_
KPNB1 Ubiquitylation K835 -0.212 0.450 _DVLK(gl)LVEAR_
KPNB1 Ubiquitylation K859 0.118 _AK(gl)TLATWATK_
KPNB1 Ubiquitylation K867 0.636 1.498 _TLATWATK(gl)ELR_
LMAN1 Ubiquitylation K96 0.601 _GSVWTK(gl)TK_
LMAN1 Ubiquitylation K346 -0.443 _IHLEIK(gl)QLNR_
LMAN1 Ubiquitylation K372 1.187 0.921 _YVSSLTEEISK(gl)R_
LMAN1 Ubiquitylation K407 0.987 _QVNEMK(gl)NSMSETVR_
LMAN1 Ubiquitylation K463 -0.810 _NMPSNEK(gl)PK_
LMAN1 Ubiquitylation K465 -0.810 _NMPSNEK(gl)PK_
MET Ubiquitylation K962 0.146 _QIK(gl)DLGSELVR_
MET Phosphorylation S988 0.064 _S(ph)VSPTTEM(ox)VSNESVDYR_
MET Phosphorylation S990 0.192 -0.105 _SVS(ph)PTTEM(ox)VSNESVDYR_
MET Phosphorylation T992 0.501 -0.048 _SVSPT(ph)TEMVSNESVDYR_
MET Phosphorylation S997 0.285 _S(ph)VSPTTEMVS(ph)NESVDYR_
PIAS1 Ubiquitylation K60 -1.191 _AGCSPAVQMKIK(gl)_
PIAS1 Ubiquitylation K341 -1.248 _VSLLCPLGK(gl)MR_
PIAS1 Phosphorylation S490 -0.898 -0.944 _RTCPSLSPTS(ph)PLNNK_
PIAS1 Phosphorylation S505 0.198 -0.250 _GILSLPHQAS(ph)PVSR_
PIK3CA Ubiquitylation K864 0.390 0.588 _NSHTIM(ox)QIQCK(gl)GGLK_
PIK3CA Ubiquitylation K868 0.204 0.651 _NSHTIM(ox)QIQCKGGLK(gl)_
PIK3CA Ubiquitylation K974 -0.273 _GAQECTK(gl)TREFER_
PIK3CB Ubiquitylation K1044 0.990 _SEEEALKQFKQK(gl)_
PIK3R2 Phosphorylation S262 -2.237 _APPPPS(ph)SPPPGGAPDGSEPSPDFPALLVEK_
PIK3R2 Phosphorylation S263 -2.237 _APPPPS(ph)SPPPGGAPDGSEPSPDFPALLVEK_
PIK3R2 Ubiquitylation K500 -0.189 _IFEEQGQTQEK(gl)CSK_
PIK3R2 Ubiquitylation K541 -0.609 _TK(gl)LEQQLR_
PIK3R2 Ubiquitylation K564 -0.431 -1.022 _MNSLK(gl)PDLMQLR_
PIK3R3 Ubiquitylation K226 -0.376 _YQQDQLVKEDNIDAVGKK(gl)_
PIK3R3 Ubiquitylation K320 0.385 _LGEIHDSK(gl)MR_
PTPN1 Phosphorylation S352 0.032 _GS(ph)PLNAAPYGIESMSQDTEVR_
PTPN1 Phosphorylation S365 -0.247 0.956 _GSPLNAAPYGIESMS(ph)QDTEVR_
PTPN1 Phosphorylation S378 1.462 1.262 _VVGGS(ph)LR_
PTPN2 Phosphorylation S304 -0.873 -0.641 _ELSKEDLSPAFDHS(ph)PNK_
SOS1 Phosphorylation S1082 0.278 _IPESETESTASAPNS(ph)PR_
SOS1 Phosphorylation S1166 0.097 -0.094 _RPESAPAES(ph)SPSK_
SRC Phosphorylation S17 -0.604 -0.689 _S(ph)LEPAENVHGAGGGAFPASQTPSKPASADGHR_
SRC Phosphorylation S75 0.060 0.331 _LFGGFNSSDTVTS(ph)PQR_
STAT1 Phosphorylation S727 1.377 0.974 _LQTTDNLLPMS(ph)PEEFDEVSR_
STAT3 Ubiquitylation K177 0.957 _VVENLQDDFDFNYK(gl)TLK_
STAT3 Ubiquitylation K180 1.179 _TLK(gl)SQGDMQDLNGNNQSVTR_
STAT3 Ubiquitylation K244 0.262 _TLTDEELADWK(gl)R_
STAT3 Phosphorylation T714 -0.338 _FICVT(ph)PTTCSNTIDLPMS(ph)PR_
STAT3 Phosphorylation S727 -0.079 0.156 _FICVTPTTCSNTIDLPMS(ph)PR_
STAT5B Phosphorylation S194 0.270 _IQAQFGPLAQLS(ph)PQER_


© Copyright Svejstrup Laboratory 2015