bioLOGIC Data » bioLOGIC CategoryView » bioLOGIC VennView » Experimental Details »

bioLOGIC Category

Results for the Category
REACTOME_PI3K_CASCADE
(Pathway_304)

RNAi screen result RNAPII IP (MG132) CSB IP CSB IP (MG132) Chrom. Chrom. (MG132) Ubi /Phospo Ubi /Phospho (MG132)
W

Protein Results:

 Results for post-translational modifications (below)
Gene name MGoogle Score RNAi high RNAi low RNAPII-IP (MG132) CSB-IP CSB-IP (MG132) Chrom. Chrom. (MG132)
RPS6 5 -1.590 2.890 0.202 -0.347 -0.009 -0.153 0.152
EEF2K 2 -1.120 2.610
INSR 2 -0.850 0.830 1.143 0.785
TSC2 1 0.810 -0.710
TSC2 1 0.810 -0.710 -0.715
PIK3R2 1 2.740 -1.180 0.269 0.348
RHEB 1 2.630 -1.320 0.991 -0.417
EIF4G1 1 -1.660 2.810 0.765
EIF4G1 1 -1.660 2.810 -0.451 -0.932 -0.258 -0.331
EIF4E 1 -2.250 4.200 0.590 0.156
EIF4E 1 -2.250 4.200 0.369
EIF4EBP1 1 2.050 -1.320
PIK3R4 1 1.400 -0.950 1.537 -1.555 0.077
PIK3CB 0 -1.390 2.350
PIK3CB 0 -0.710 1.450
EIF4B 0 -0.020 0.470 -0.169 -0.233 -0.211 -0.927 -0.212
FGFR3 0 -1.120 1.390
FGFR1 0 0.210 0.150
PIK3C3 0 -0.260 0.520
PPM1A 0 -0.680 1.340 0.402
PPM1A 0 -0.680 1.340 -1.556 -0.874
AKT2 0 -1.420 2.210 -0.194
PRKAG2 0 1.300 -0.990 0.278 -0.667
RPS6KB1 0 0.850 -0.600
GAB1 0 1.950 -1.110
PRKAB1 0 0.640 -1.180
STK11 0
PIK3CA 0
PRKAA1 0 0.910 0.060
CAB39 0 -0.920 0.670
PDPK1 0 0.050 -0.440
RPTOR 0 0.520 -1.030 0.623 0.466
PIK3R1 0 1.910 -1.220 -0.441 0.147
PRKAA2 0 -0.030 -0.350
PRKAA2 0 -0.030 -0.350
TSC1 0 1.100 -0.150
MLST8 0 -0.170 0.220
IRS1 0
GRB2 0 -0.240 0.300 -1.021 0.057 0.906
PRKAG1 0 0.400 -0.420 0.278 -0.667
IRS2 0 -0.190 -0.130
MTOR 0 -0.680 0.150 0.757 0.074 0.101
STRADA 0

PTM Sites:

 Back to Protein Results
Gene name PTM type PTM site UV UV (MG132) Sequence
AKT2 Ubiquitylation K14 0.306 0.070 _EGWLHK(gl)R_
AKT2 Ubiquitylation K111 1.082 _AIQMVANSLK(gl)QR_
AKT2 Ubiquitylation K160 0.251 _LLGK(gl)GTFGK_
AKT2 Phosphorylation T451 -0.091 -0.612 _YFDDEFTAQSITIT(ph)PPDRYDSLGLLELDQR_
AKT2 Phosphorylation Y456 -0.265 _YFDDEFTAQSITITPPDRY(ph)DSLGLLELDQR_
CAB39 Ubiquitylation K20 0.992 _NLK(gl)ESMAVLEK_
EEF2K Phosphorylation S18 0.197 0.661 _LEGVDGGQS(ph)PR_
EEF2K Ubiquitylation K65 0.734 _YYSNLTK(gl)SER_
EEF2K Ubiquitylation K341 2.006 -0.155 _DAVNQNTK(gl)LLQSAK_
EEF2K Phosphorylation S445 -0.049 _ESENSGDSGYPS(ph)EKRGELDDPEPR_
EEF2K Phosphorylation S470 0.044 0.565 _KYES(ph)DEDSLGSSGR_
EEF2K Ubiquitylation K485 1.702 1.119 _VCVEK(gl)WNLLNSSR_
EIF4B Phosphorylation S93 -0.425 -0.444 _S(ph)PPYTAFLGNLPYDVTEESIKEFFR_
EIF4B Phosphorylation S207 -0.235 0.162 _ARPATDS(ph)FDDYPPR_
EIF4B Phosphorylation S283 0.453 0.543 _AFGS(ph)GYR_
EIF4B Ubiquitylation K365 0.071 _AASIFGGAK(gl)PVDTAAR_
EIF4B Phosphorylation S464 -0.446 0.097 _EEDCHS(ph)PTSKPPKPDQPLK_
EIF4E Ubiquitylation K147 -0.433 0.065 _WLITLNK(gl)QQR_
EIF4EBP1 Phosphorylation Y34 -1.060 _RVVLGDGVQLPPGDY(ph)STTPGGTLFS(ph)TTPGGTR_
EIF4EBP1 Phosphorylation S35 -0.849 _RVVLGDGVQLPPGDYS(ph)TTPGGTLFS(ph)TTPGGTR_
EIF4EBP1 Phosphorylation T37 -0.768 -0.583 _RVVLGDGVQLPPGDYSTT(ph)PGGTLFSTT(ph)PGGTR_
EIF4EBP1 Phosphorylation T41 -3.655 -0.903 _RVVLGDGVQLPPGDYST(ph)TPGGT(ph)LFSTTPGGTR_
EIF4EBP1 Phosphorylation S44 -0.796 _VVLGDGVQLPPGDYSTTPGGTLFS(ph)T(ph)TPGGTR_
EIF4EBP1 Phosphorylation T45 -0.727 _VVLGDGVQLPPGDYSTTPGGTLFS(ph)T(ph)TPGGTR_
EIF4EBP1 Phosphorylation T46 -0.890 -0.817 _RVVLGDGVQLPPGDYSTT(ph)PGGTLFSTT(ph)PGGTR_
EIF4EBP1 Phosphorylation S65 0.522 0.478 _NS(ph)PVTKT(ph)PPR_
EIF4EBP1 Phosphorylation T68 -1.621 -2.402 _NS(ph)PVT(ph)KTPPRDLPTIPGVTSPSSDEPPMEASQSHLR_
EIF4EBP1 Ubiquitylation K69 -1.171 -1.547 _NSPVTK(gl)TPPR_
EIF4EBP1 Phosphorylation T70 -0.702 -0.017 _NSPVTKT(ph)PPR_
EIF4EBP1 Phosphorylation T77 -1.921 -1.898 _TPPRDLPT(ph)IPGVTSPSSDEPPMEASQSHLR_
EIF4EBP1 Phosphorylation T82 1.253 _DLPTIPGVT(ph)SPSSDEPPMEASQSHLR_
EIF4EBP1 Phosphorylation S83 1.211 0.339 _DLPTIPGVTS(ph)PSSDEPPMEASQSHLR_
EIF4EBP1 Phosphorylation S96 -1.541 _DLPTIPGVTSPSSDEPPMEASQS(ph)HLRNSPEDK_
EIF4EBP1 Phosphorylation S101 -1.900 -1.976 _DLPTIPGVTSPSSDEPPMEASQSHLRNS(ph)PEDK_
EIF4G1 Ubiquitylation K627 -0.658 _SDQWK(gl)PLNLEEK_
EIF4G1 Ubiquitylation K635 -1.721 -1.834 _SDQWKPLNLEEKK(gl)_
EIF4G1 Phosphorylation T672 -1.605 _ANKT(ph)PLRPLDPTR_
EIF4G1 Ubiquitylation K925 0.326 _SLGNIK(gl)FIGELFK_
EIF4G1 Ubiquitylation K975 -0.759 _DLDFEK(gl)AKPR_
EIF4G1 Phosphorylation T1098 -0.123 _IT(ph)KPGSIDSNNQLFAPGGR_
EIF4G1 Phosphorylation S1102 0.238 -0.562 _ITKPGS(ph)IDSNNQLFAPGGR_
EIF4G1 Phosphorylation S1117 -0.554 _ITKPGSIDSNNQLFAPGGRLS(ph)WGK_
EIF4G1 Phosphorylation S1210 0.417 1.061 _S(ph)FSKEVEER_
EIF4G1 Phosphorylation S1212 1.007 0.725 _RSFS(ph)KEVEER_
EIF4G1 Phosphorylation S1234 0.676 1.054 _AAS(ph)LTEDRDR_
EIF4G1 Phosphorylation T1236 1.002 _KAAS(ph)LTEDRDR_
EIF4G1 Phosphorylation S1256 -1.072 -0.563 _REAALPPVS(ph)PLK_
EIF4G1 Phosphorylation S1263 0.713 0.836 _AALS(ph)EEELEKK_
FGFR1 Ubiquitylation K510 1.047 -0.221 _VTK(gl)VAVK_
FGFR3 Ubiquitylation K205 -0.115 _IGGIK(gl)LR_
GAB1 Phosphorylation S266 0.756 0.551 _SYS(ph)HDVLPK_
GAB1 Phosphorylation S367 0.230 0.176 _TAS(ph)DTDSSYCIPTAGMS(ph)PSR_
GAB1 Phosphorylation T369 -0.352 _TASDT(ph)DSSYCIPTAGMS(ph)PSR_
GAB1 Phosphorylation S381 -0.481 0.139 _TASDTDSSYCIPTAGM(ox)S(ph)PSR_
GAB1 Phosphorylation S401 0.266 0.788 _DAS(ph)SQDCYDIPR_
GAB1 Phosphorylation S402 0.328 0.633 _DASS(ph)QDCYDIPR_
GAB1 Phosphorylation S419 0.540 _SSS(ph)LEGFHNHFK_
GRB2 Ubiquitylation K10 0.146 _YDFK(gl)ATADDELSFK_
GRB2 Ubiquitylation K20 -0.078 _ATADDELSFK(gl)R_
GRB2 Ubiquitylation K69 -0.362 0.641 _AK(gl)AEEMLSK_
GRB2 Ubiquitylation K76 0.754 _AEEMLSK(gl)QR_
GRB2 Ubiquitylation K109 0.381 -0.002 _FGNDVQHFK(gl)VLR_
INSR Ubiquitylation K1022 -0.603 _EK(gl)ITLLR_
INSR Ubiquitylation K1047 0.305 0.711 _DIIK(gl)GEAETR_
INSR Ubiquitylation K1057 0.482 0.484 _VAVK(gl)TVNESASLR_
INSR Ubiquitylation K1352 1.606 2.754 _DGGSSLGFK(gl)R_
IRS1 Phosphorylation S1101 -0.078 _HSS(ph)ETFSSTPSATR_
IRS2 Phosphorylation S308 -0.079 -0.510 _SKS(ph)QSSGSSATHPISVPGAR_
IRS2 Phosphorylation T365 0.641 0.852 _T(ph)ASEGDGGAAAGAAAAGAR_
IRS2 Phosphorylation S367 0.757 0.612 _TAS(ph)EGDGGAAAGAAAAGAR_
IRS2 Phosphorylation S393 -1.580 -1.221 _PVSVAGSPLS(ph)PGPVR_
IRS2 Phosphorylation S520 0.359 -1.006 _S(ph)NTPESIAETPPAR_
IRS2 Phosphorylation T522 -1.103 -0.770 _SNT(ph)PESIAETPPAR_
IRS2 Phosphorylation T529 0.230 0.164 _S(ph)NTPESIAET(ph)PPAR_
IRS2 Phosphorylation S562 -0.026 0.439 _RVS(ph)GDAAQDLDR_
IRS2 Phosphorylation S579 0.542 0.362 _RTYS(ph)LTTPAR_
IRS2 Phosphorylation S621 -0.190 _LCPSCPAS(ph)SPK_
IRS2 Phosphorylation S622 -0.195 _LCPSCPASS(ph)PK_
IRS2 Phosphorylation S681 0.409 _SDDYM(ox)PM(ox)S(ph)PASVSAPK_
IRS2 Phosphorylation S732 -1.089 _AS(ph)SPAESSPEDSGYM(ox)R_
IRS2 Phosphorylation S733 -1.027 0.522 _ASS(ph)PAESSPEDSGYM(ox)R_
IRS2 Phosphorylation S738 0.522 _ASS(ph)PAESS(ph)PEDSGYMR_
IRS2 Phosphorylation S917 -0.592 -1.025 _S(ph)PGEYINIDFGEPGAR_
IRS2 Phosphorylation S1164 -0.499 _HSSETFSSTTTVTPVS(ph)PSFAHNPK_
IRS2 Phosphorylation S1178 0.766 0.277 _HNSAS(ph)VENVSLR_
IRS2 Phosphorylation T1204 -0.454 _SSEGGVGVGPGGGDEPPT(ph)SPR_
IRS2 Phosphorylation S1205 -0.291 _SSEGGVGVGPGGGDEPPTS(ph)PR_
MLST8 Phosphorylation T3 -0.481 _(ac)MNT(ph)SPGTVGSDPVILATAGYDHTVR_
MLST8 Ubiquitylation K245 -0.114 0.462 _FSPDSTLLATCSADQTCK(gl)IWR_
MTOR Ubiquitylation K309 -0.762 0.065 _DLMGFGTK(gl)PR_
MTOR Ubiquitylation K1257 -1.167 -0.901 _SGQGDALASGPVETGPMKK(gl)_
MTOR Ubiquitylation K1395 -1.255 _AYAK(gl)ALHYK_
MTOR Ubiquitylation K2066 -1.004 _GPQTLK(gl)ETSFNQAYGR_
MTOR Ubiquitylation K2166 -1.304 _IQSIAPSLQVITSK(gl)QRPR_
MTOR Phosphorylation T2471 0.329 _KT(ph)GTTVPESIHSFIGDGLVKPEALNK_
PDPK1 Phosphorylation S241 0.358 0.361 _ANS(ph)FVGTAQYVSPELLTEK_
PDPK1 Ubiquitylation K257 0.571 -0.234 _ANSFVGTAQYVSPELLTEK(gl)SACK_
PIK3C3 Ubiquitylation K29 0.271 _IGSLEGK(gl)R_
PIK3C3 Ubiquitylation K158 -1.333 _VWPNVEADGSEPTK(gl)TPGR_
PIK3C3 Ubiquitylation K209 -1.012 _EIEMINESEK(gl)R_
PIK3C3 Ubiquitylation K287 -1.261 _SGPSDHDLK(gl)PNAATR_
PIK3CA Ubiquitylation K864 0.390 0.588 _NSHTIM(ox)QIQCK(gl)GGLK_
PIK3CA Ubiquitylation K868 0.204 0.651 _NSHTIM(ox)QIQCKGGLK(gl)_
PIK3CA Ubiquitylation K974 -0.273 _GAQECTK(gl)TREFER_
PIK3CB Ubiquitylation K1044 0.990 _SEEEALKQFKQK(gl)_
PIK3R2 Phosphorylation S262 -2.237 _APPPPS(ph)SPPPGGAPDGSEPSPDFPALLVEK_
PIK3R2 Phosphorylation S263 -2.237 _APPPPS(ph)SPPPGGAPDGSEPSPDFPALLVEK_
PIK3R2 Ubiquitylation K500 -0.189 _IFEEQGQTQEK(gl)CSK_
PIK3R2 Ubiquitylation K541 -0.609 _TK(gl)LEQQLR_
PIK3R2 Ubiquitylation K564 -0.431 -1.022 _MNSLK(gl)PDLMQLR_
PPM1A Ubiquitylation K278 -0.176 _VCNEVVDTCLYK(gl)GSR_
PRKAA1 Ubiquitylation K271 -0.536 _ATIK(gl)DIR_
PRKAA1 Ubiquitylation K396 -0.419 _HTLDELNPQK(gl)SK_
PRKAA1 Ubiquitylation K485 -1.326 -1.554 _SIDDEITEAK(gl)SGTATPQR_
PRKAA2 Ubiquitylation K271 -0.536 _ATIK(gl)DIR_
PRKAA2 Phosphorylation S377 -0.020 _MPPLIADS(ph)PK_
PRKAB1 Phosphorylation S108 -0.357 0.129 _S(ph)HNNFVAILDLPEGEHQYK_
PRKAG1 Ubiquitylation K78 -0.588 _AAPLWDSK(gl)K_
PRKAG1 Ubiquitylation K79 -0.588 _AAPLWDSK(gl)K_
PRKAG1 Ubiquitylation K243 -0.525 -0.505 _VSALPVVDEK(gl)GR_
PRKAG2 Ubiquitylation K78 -0.588 _AAPLWDSK(gl)K_
PRKAG2 Ubiquitylation K79 -0.588 _AAPLWDSK(gl)K_
PRKAG2 Ubiquitylation K243 -0.525 -0.505 _VSALPVVDEK(gl)GR_
RHEB Ubiquitylation K121 -0.852 _VQIPIMLVGNKK(gl)_
RPS6 Ubiquitylation K58 2.088 1.670 _ISGGNDK(gl)QGFPMK_
RPS6 Phosphorylation S235 2.968 _LS(ph)SLRAS(ph)TSK_
RPS6 Phosphorylation S236 2.333 3.174 _LSS(ph)LRAS(ph)TSK_
RPS6 Phosphorylation S240 2.384 2.672 _LSSLRAS(ph)TSK_
RPS6 Phosphorylation T241 3.252 3.164 _LSS(ph)LRAST(ph)SK_
RPS6KB1 Ubiquitylation K99 -0.316 _VLGK(gl)GGYGK_
RPS6KB1 Phosphorylation S447 -0.525 -0.458 _TPVS(ph)PVKFSPGDFWGR_
RPTOR Phosphorylation S722 0.393 1.196 _SVSS(ph)YGNIR_
RPTOR Phosphorylation T857 -0.348 _VLDTSSLT(ph)QSAPAS(ph)PTNK_
RPTOR Phosphorylation S859 -0.462 -0.346 _VLDTSSLTQS(ph)APASPT(ph)NK_
RPTOR Phosphorylation S863 -0.208 -0.001 _VLDTSSLTQS(ph)APAS(ph)PTNK_
RPTOR Phosphorylation T865 -0.317 _VLDTSSLTQS(ph)APASPT(ph)NK_
RPTOR Phosphorylation S877 -0.114 -0.074 _GVHIHQAGGS(ph)PPASSTSSSSLTNDVAK_
RPTOR Ubiquitylation K1008 -0.329 _QAQQVIQK(gl)GITR_
STK11 Phosphorylation S31 0.437 0.073 _IDS(ph)TEVIYQPR_
STK11 Phosphorylation T32 1.256 0.248 _IDS(ph)TEVIYQPR_
STRADA Ubiquitylation K7 -0.518 _(ac)SFLVSK(gl)PER_
TSC1 Phosphorylation S505 0.141 0.350 _GGFDS(ph)PFYR_
TSC2 Ubiquitylation K3 -1.397 _(ac)AK(gl)PTSKDSGLK_
TSC2 Ubiquitylation K14 -1.297 _DSGLKEK(gl)FK_
TSC2 Ubiquitylation K69 0.051 _MIGQICEVAK(gl)TK_
TSC2 Ubiquitylation K71 -0.157 _MIGQICEVAKTK(gl)_
TSC2 Ubiquitylation K258 -0.278 _ELCEPCWK(gl)LMR_
TSC2 Ubiquitylation K634 1.610 _LGLPNK(gl)DGVVR_
TSC2 Phosphorylation S950 -0.152 -0.529 _STS(ph)LNERPK_
TSC2 Phosphorylation S1064 -0.927 _SLLGLDSGELQSGPESSSS(ph)PGVHVR_
TSC2 Phosphorylation S1248 -0.604 _SNTDSAVVMEEGS(ph)PGEVPVLVEPPGLEDVEAALGMDRR_
TSC2 Phosphorylation S1329 -0.120 _S(ph)SSSPELQTLQDILGDPGDK_
TSC2 Phosphorylation S1331 -0.262 _SSS(ph)SPELQTLQDILGDPGDKADVGR_
TSC2 Phosphorylation S1332 -0.063 _SSSS(ph)PELQTLQDILGDPGDK_
TSC2 Phosphorylation S1355 0.174 0.351 _ADVGRLS(ph)PEVK_
TSC2 Phosphorylation S1362 0.859 _S(ph)QSGTLDGESAAWSASGEDSR_
TSC2 Phosphorylation S1364 0.522 0.550 _SQS(ph)GTLDGESAAWSASGEDSR_
TSC2 Phosphorylation T1366 0.137 _SQSGT(ph)LDGESAAWSASGEDSR_
TSC2 Phosphorylation S1396 0.498 _S(ph)PSGLRPR_
TSC2 Phosphorylation S1743 0.596 _RLISS(ph)VEDFTEFV_


.

© Copyright Svejstrup Laboratory 2015